BLASTX nr result
ID: Ophiopogon27_contig00049518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00049518 (895 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OGY32724.1| hypothetical protein A3C02_03770 [Candidatus Ande... 65 2e-08 gb|OLE02380.1| 2,3-diaminopropionate biosynthesis protein SbnB [... 61 6e-07 gb|OLB44026.1| 2,3-diaminopropionate biosynthesis protein SbnB [... 61 6e-07 gb|PFI05670.1| 2,3-diaminopropionate biosynthesis protein SbnB, ... 57 8e-07 ref|WP_010314166.1| 2,3-diaminopropionate biosynthesis protein S... 60 1e-06 gb|PKW18196.1| ornithine cyclodeaminase [Saccharopolyspora spinosa] 60 1e-06 ref|WP_098708902.1| 2,3-diaminopropionate biosynthesis protein S... 60 1e-06 ref|WP_098656146.1| 2,3-diaminopropionate biosynthesis protein S... 60 1e-06 ref|WP_098650389.1| 2,3-diaminopropionate biosynthesis protein S... 60 1e-06 ref|WP_097815573.1| 2,3-diaminopropionate biosynthesis protein S... 60 1e-06 ref|WP_070169519.1| MULTISPECIES: 2,3-diaminopropionate biosynth... 60 1e-06 ref|WP_081162829.1| hypothetical protein [Geobacillus sp. 44B] >... 57 2e-06 ref|WP_098838734.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_098349023.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_098395344.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_098394743.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_097988268.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_097920772.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_097914465.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 ref|WP_086398098.1| 2,3-diaminopropionate biosynthesis protein S... 59 3e-06 >gb|OGY32724.1| hypothetical protein A3C02_03770 [Candidatus Andersenbacteria bacterium RIFCSPHIGHO2_02_FULL_45_11] gb|OGY34491.1| hypothetical protein A3D99_03280 [Candidatus Andersenbacteria bacterium RIFCSPHIGHO2_12_FULL_45_11] Length = 322 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDIIELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDIF 714 DW QC +A+KV K +D+GL + D EL ++LFG K + F G +VNPLGM++EDI Sbjct: 243 DWRQCRKAEKVLKSAIDQGLVLQADTHELSNILFGPMKHKHF-PGRTIVNPLGMALEDIV 301 Query: 713 VAKALYEKV 687 A +Y++V Sbjct: 302 TAWEIYQQV 310 >gb|OLE02380.1| 2,3-diaminopropionate biosynthesis protein SbnB [Ktedonobacter sp. 13_1_20CM_4_53_11] Length = 342 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW QC + +KV Q V +G F RE + EL +L G+ R E I+++NP+G++IED+ Sbjct: 261 DWDQCNREKKVLNQLVQEGHFSREQLHAELGQILIGQRPGRESNEEIILLNPIGIAIEDV 320 Query: 716 FVAKALYEKVM 684 A A+Y+K + Sbjct: 321 ACAHAIYQKAL 331 >gb|OLB44026.1| 2,3-diaminopropionate biosynthesis protein SbnB [Ktedonobacter sp. 13_2_20CM_53_11] gb|OLB61647.1| 2,3-diaminopropionate biosynthesis protein SbnB [Ktedonobacter sp. 13_2_20CM_2_54_8] Length = 342 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW QC + +KV Q V +G F RE + EL +L G+ R E I+++NP+G++IED+ Sbjct: 261 DWDQCNREKKVLNQLVQEGHFSREQLHAELGQILIGQRPGRESNEEIILLNPIGIAIEDV 320 Query: 716 FVAKALYEKVM 684 A A+Y+K + Sbjct: 321 ACAHAIYQKAL 331 >gb|PFI05670.1| 2,3-diaminopropionate biosynthesis protein SbnB, partial [Bacillus cereus] Length = 100 Score = 57.0 bits (136), Expect = 8e-07 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 19 DWDQANREKKVINQLFVEGKFSKEMLHAELVDVITGKKLGRVTDEEIIILNPMGMAIEDI 78 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 79 ACAHAIYEK 87 >ref|WP_010314166.1| 2,3-diaminopropionate biosynthesis protein SbnB [Saccharopolyspora spinosa] Length = 329 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW QC + +K+ Q V +G F RE + EL ++L G RT + I+++NP+GM++EDI Sbjct: 248 DWEQCNREKKIINQLVLEGSFSREQLHAELGEILAGTKSGRTDDDEIILLNPMGMAVEDI 307 Query: 716 FVAKALYEK 690 A A+YE+ Sbjct: 308 ACAGAVYER 316 >gb|PKW18196.1| ornithine cyclodeaminase [Saccharopolyspora spinosa] Length = 337 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW QC + +K+ Q V +G F RE + EL ++L G RT + I+++NP+GM++EDI Sbjct: 256 DWEQCNREKKIINQLVLEGSFSREQLHAELGEILAGTKSGRTDDDEIILLNPMGMAVEDI 315 Query: 716 FVAKALYEK 690 A A+YE+ Sbjct: 316 ACAGAVYER 324 >ref|WP_098708902.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PGD50842.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] Length = 339 Score = 60.1 bits (144), Expect = 1e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKSGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_098656146.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PGB60190.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PGD69808.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] Length = 339 Score = 60.1 bits (144), Expect = 1e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKSGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_098650389.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PFZ87951.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] Length = 339 Score = 60.1 bits (144), Expect = 1e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKSGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_097815573.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PDY40621.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] Length = 339 Score = 60.1 bits (144), Expect = 1e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKSGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_070169519.1| MULTISPECIES: 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus] emb|SCB92114.1| Ornithine cyclodeaminase/mu-crystallin family protein [Bacillus cereus] gb|OFC95371.1| alanine dehydrogenase [Bacillus thuringiensis] gb|OWT47577.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus sp. K2I17] gb|PEJ38772.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PEU23616.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PHA19860.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PHA50721.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] gb|PHB13037.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus wiedmannii] Length = 339 Score = 60.1 bits (144), Expect = 1e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKSGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_081162829.1| hypothetical protein [Geobacillus sp. 44B] gb|OQO97873.1| hypothetical protein BSK33_17685 [Geobacillus sp. 44B] Length = 152 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDII-ELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 71 DWEQANREKKVIHQLVLEGKFSKEQLYAELGDIVIGKKVGRENDEEIIILNPMGMAIEDI 130 Query: 716 FVAKALYEKVM 684 A A+Y++ + Sbjct: 131 ACAYAIYQRAV 141 >ref|WP_098838734.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PGS79852.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_098349023.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFE10644.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFU80828.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_098395344.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus cereus] gb|PEW16208.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus cereus] gb|PFD39043.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus cereus] gb|PFH83087.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus cereus] gb|PFU83033.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus cereus] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_098394743.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PEV38817.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFR66312.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFT75866.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFV85055.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_097988268.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PEE67118.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_097920772.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PEE61707.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PEE85352.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PFM86391.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_097914465.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|PEA11960.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326 >ref|WP_086398098.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis] gb|OUB69643.1| 2,3-diaminopropionate biosynthesis protein SbnB [Bacillus thuringiensis serovar dakota] Length = 339 Score = 59.3 bits (142), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -3 Query: 893 DWFQCTQAQKVFKQGVDKGLFKREDI-IELPDLLFGKSKDRTFQEGIVMVNPLGMSIEDI 717 DW Q + +KV Q V +G F +E + EL D++ GK R E I+++NP+GM+IEDI Sbjct: 258 DWDQANREKKVINQLVVEGKFSKEMLHAELGDIITGKKLGRVTDEEIIILNPMGMAIEDI 317 Query: 716 FVAKALYEK 690 A A+YEK Sbjct: 318 ACAHAIYEK 326