BLASTX nr result
ID: Ophiopogon27_contig00048346
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00048346 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY12833.1| hypothetical protein RhiirB3_479500 [Rhizophagus ... 95 2e-19 dbj|GBC53777.1| gamma-tubulin complex component gcp4 [Rhizophagu... 95 2e-19 gb|PKY45586.1| hypothetical protein RhiirA4_401417 [Rhizophagus ... 95 2e-19 gb|PKK69059.1| hypothetical protein RhiirC2_749057 [Rhizophagus ... 95 2e-19 gb|EXX69676.1| Spc98p [Rhizophagus irregularis DAOM 197198w] >gi... 95 2e-19 >gb|PKY12833.1| hypothetical protein RhiirB3_479500 [Rhizophagus irregularis] Length = 661 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 131 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS Sbjct: 619 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 661 >dbj|GBC53777.1| gamma-tubulin complex component gcp4 [Rhizophagus irregularis DAOM 181602] gb|POG75049.1| gamma-tubulin complex component protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 687 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 131 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS Sbjct: 645 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 687 >gb|PKY45586.1| hypothetical protein RhiirA4_401417 [Rhizophagus irregularis] Length = 691 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 131 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS Sbjct: 649 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 691 >gb|PKK69059.1| hypothetical protein RhiirC2_749057 [Rhizophagus irregularis] Length = 691 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 131 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS Sbjct: 649 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 691 >gb|EXX69676.1| Spc98p [Rhizophagus irregularis DAOM 197198w] gb|PKC17701.1| hypothetical protein RhiirA5_481399 [Rhizophagus irregularis] gb|PKC75599.1| hypothetical protein RhiirA1_499677 [Rhizophagus irregularis] Length = 691 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 131 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS Sbjct: 649 VMFLFRTLSGVNKTGGDFGGPPRHLDQLLLRLDYSKWFSVWSS 691