BLASTX nr result
ID: Ophiopogon27_contig00048110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00048110 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK71731.1| hypothetical protein RhiirC2_412572 [Rhizophagus ... 97 1e-22 gb|POG76780.1| hypothetical protein GLOIN_2v1552276 [Rhizophagus... 98 1e-21 gb|PKY42379.1| hypothetical protein RhiirA4_397336 [Rhizophagus ... 97 4e-21 dbj|GBC23029.1| hypothetical protein RIR_0993200 [Rhizophagus ir... 98 5e-21 gb|EXX68927.1| hypothetical protein RirG_100590 [Rhizophagus irr... 98 5e-21 gb|PKC60401.1| hypothetical protein RhiirA1_468073 [Rhizophagus ... 98 5e-21 gb|PKC11909.1| hypothetical protein RhiirA5_465838 [Rhizophagus ... 97 1e-20 gb|PKY60380.1| hypothetical protein RhiirA4_412697 [Rhizophagus ... 91 3e-19 gb|PKB97000.1| hypothetical protein RhiirA5_506774 [Rhizophagus ... 77 1e-13 >gb|PKK71731.1| hypothetical protein RhiirC2_412572 [Rhizophagus irregularis] gb|PKY18816.1| hypothetical protein RhiirB3_116310 [Rhizophagus irregularis] Length = 165 Score = 96.7 bits (239), Expect = 1e-22 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWM+K+ IMDCVDTV Q QNSTDF QELV MGTETPP SIVLPWSCDT+ Sbjct: 112 VLTSVWMVKRIIMDCVDTVNSQVQNSTDFKQELVAMGTETPPQSIVLPWSCDTK 165 >gb|POG76780.1| hypothetical protein GLOIN_2v1552276 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 331 Score = 97.8 bits (242), Expect = 1e-21 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWMLKK I+DCVD V Q QNSTDF QEL+ MGTETPPPSIVLPWSCDT+ Sbjct: 278 VLTSVWMLKKMIVDCVDIVNSQVQNSTDFKQELIAMGTETPPPSIVLPWSCDTK 331 >gb|PKY42379.1| hypothetical protein RhiirA4_397336 [Rhizophagus irregularis] Length = 357 Score = 96.7 bits (239), Expect = 4e-21 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWM+K+ IMDCVDTV Q QNSTDF QELV MGTETPP SIVLPWSCDT+ Sbjct: 304 VLTSVWMVKRIIMDCVDTVNSQVQNSTDFKQELVAMGTETPPQSIVLPWSCDTK 357 >dbj|GBC23029.1| hypothetical protein RIR_0993200 [Rhizophagus irregularis DAOM 181602] Length = 520 Score = 97.8 bits (242), Expect = 5e-21 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWMLKK I+DCVD V Q QNSTDF QEL+ MGTETPPPSIVLPWSCDT+ Sbjct: 467 VLTSVWMLKKMIVDCVDIVNSQVQNSTDFKQELIAMGTETPPPSIVLPWSCDTK 520 >gb|EXX68927.1| hypothetical protein RirG_100590 [Rhizophagus irregularis DAOM 197198w] Length = 528 Score = 97.8 bits (242), Expect = 5e-21 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWMLKK I+DCVD V Q QNSTDF QEL+ MGTETPPPSIVLPWSCDT+ Sbjct: 475 VLTSVWMLKKMIVDCVDIVNSQVQNSTDFKQELIAMGTETPPPSIVLPWSCDTK 528 >gb|PKC60401.1| hypothetical protein RhiirA1_468073 [Rhizophagus irregularis] gb|PKY29965.1| hypothetical protein RhiirB3_446821 [Rhizophagus irregularis] Length = 591 Score = 97.8 bits (242), Expect = 5e-21 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWMLKK I+DCVD V Q QNSTDF QEL+ MGTETPPPSIVLPWSCDT+ Sbjct: 538 VLTSVWMLKKMIVDCVDIVNSQVQNSTDFKQELIAMGTETPPPSIVLPWSCDTK 591 >gb|PKC11909.1| hypothetical protein RhiirA5_465838 [Rhizophagus irregularis] Length = 667 Score = 96.7 bits (239), Expect = 1e-20 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VLTSVWM+K+ IMDCVDTV Q QNSTDF QELV MGTETPP SIVLPWSCDT+ Sbjct: 614 VLTSVWMVKRIIMDCVDTVNSQVQNSTDFKQELVAMGTETPPQSIVLPWSCDTK 667 >gb|PKY60380.1| hypothetical protein RhiirA4_412697 [Rhizophagus irregularis] Length = 322 Score = 91.3 bits (225), Expect = 3e-19 Identities = 42/54 (77%), Positives = 45/54 (83%) Frame = +2 Query: 2 VLTSVWMLKKAIMDCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 VL SVWM+K+ IMDCVD V Q QNSTDF QELV MGTETPP SIVLPWSCDT+ Sbjct: 269 VLGSVWMVKRIIMDCVDIVNSQVQNSTDFKQELVAMGTETPPNSIVLPWSCDTK 322 >gb|PKB97000.1| hypothetical protein RhiirA5_506774 [Rhizophagus irregularis] Length = 523 Score = 76.6 bits (187), Expect = 1e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 41 DCVDTVTLQAQNSTDFSQELVTMGTETPPPSIVLPWSCDTR 163 DCVD V Q QNSTDF QEL+ MGTETPPPSIVLPWSCDT+ Sbjct: 483 DCVDIVNSQVQNSTDFKQELIAMGTETPPPSIVLPWSCDTK 523