BLASTX nr result
ID: Ophiopogon27_contig00047906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047906 (717 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74530.1| hypothetical protein RirG_050280 [Rhizophagus irr... 143 1e-37 >gb|EXX74530.1| hypothetical protein RirG_050280 [Rhizophagus irregularis DAOM 197198w] dbj|GBC52123.1| hypothetical protein RIR_3353300 [Rhizophagus irregularis DAOM 181602] gb|PKC14145.1| hypothetical protein RhiirA5_409753 [Rhizophagus irregularis] gb|PKC73135.1| hypothetical protein RhiirA1_451512 [Rhizophagus irregularis] gb|PKY15236.1| hypothetical protein RhiirB3_427401 [Rhizophagus irregularis] gb|POG59512.1| hypothetical protein GLOIN_2v1789038 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 324 Score = 143 bits (361), Expect = 1e-37 Identities = 68/109 (62%), Positives = 88/109 (80%) Frame = +3 Query: 198 QSQLKEQTTSQPSVLKTSEGGSNSFNSKTPEQQLEIMKYWLDEYYKHNRFDPTISDLTSG 377 Q++++E + S P + ++ S S +T EQQLEIMKYWLD+Y+K NRFDP ISDLTSG Sbjct: 209 QTKVQETSDSSPDSPENTKSWSRS---QTREQQLEIMKYWLDKYHKKNRFDPVISDLTSG 265 Query: 378 RPWNEIEGKLLSQFMPVFKRYLSDNYVNTRTGDFYSLFFAALKDKHKVS 524 +PWNEIEGKLLS+FMPVFKRYL DN +++RT +FY LFF AL+DKHK++ Sbjct: 266 KPWNEIEGKLLSRFMPVFKRYLLDNGLSSRTSEFYFLFFTALRDKHKIA 314