BLASTX nr result
ID: Ophiopogon27_contig00047802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047802 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY44921.1| hypothetical protein RhiirA4_157502 [Rhizophagus ... 73 3e-12 gb|EXX79852.1| hypothetical protein RirG_001620 [Rhizophagus irr... 73 3e-12 gb|ORX96818.1| hypothetical protein K493DRAFT_314324 [Basidiobol... 57 1e-06 ref|XP_021886730.1| hypothetical protein BCR41DRAFT_366718 [Lobo... 55 9e-06 >gb|PKY44921.1| hypothetical protein RhiirA4_157502 [Rhizophagus irregularis] Length = 284 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 141 WIFRKWKLSPSRNFKEKIQPVSYVSERSPESDTVFLRELNEP 16 WIFRKWKLSPSRNFKEKIQPV++ + R+ ESDT+FLRELNEP Sbjct: 244 WIFRKWKLSPSRNFKEKIQPVNF-TPRTHESDTMFLRELNEP 284 >gb|EXX79852.1| hypothetical protein RirG_001620 [Rhizophagus irregularis DAOM 197198w] gb|EXX79853.1| hypothetical protein RirG_001620 [Rhizophagus irregularis DAOM 197198w] gb|EXX79854.1| hypothetical protein RirG_001620 [Rhizophagus irregularis DAOM 197198w] gb|PKC15130.1| hypothetical protein RhiirA5_3758 [Rhizophagus irregularis] gb|PKC70239.1| hypothetical protein RhiirA1_414591 [Rhizophagus irregularis] gb|PKK77913.1| hypothetical protein RhiirC2_861619 [Rhizophagus irregularis] gb|PKY14923.1| hypothetical protein RhiirB3_238494 [Rhizophagus irregularis] Length = 284 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 141 WIFRKWKLSPSRNFKEKIQPVSYVSERSPESDTVFLRELNEP 16 WIFRKWKLSPSRNFKEKIQPV++ + R+ ESDT+FLRELNEP Sbjct: 244 WIFRKWKLSPSRNFKEKIQPVNF-TPRTHESDTMFLRELNEP 284 >gb|ORX96818.1| hypothetical protein K493DRAFT_314324 [Basidiobolus meristosporus CBS 931.73] Length = 260 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 8/49 (16%) Frame = -2 Query: 141 WIFRKWKLSPSRNFKEKI--------QPVSYVSERSPESDTVFLRELNE 19 W+FRKWKL PSRNFK+KI P SY S + + D VFLRELNE Sbjct: 212 WVFRKWKLKPSRNFKDKINSDTDNFFSPPSYTSSVNRDRDAVFLRELNE 260 >ref|XP_021886730.1| hypothetical protein BCR41DRAFT_366718 [Lobosporangium transversale] gb|ORZ29057.1| hypothetical protein BCR41DRAFT_366718 [Lobosporangium transversale] Length = 325 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -2 Query: 141 WIFRKWKLSPSRNFKEKIQPVSYVS-ERSPESDTVFLRELNE 19 W+FRKWKLSPSRNF+ KI+ Y RS ESDTVFLR L + Sbjct: 151 WVFRKWKLSPSRNFQSKIRGDDYQDYPRSYESDTVFLRNLGD 192