BLASTX nr result
ID: Ophiopogon27_contig00047795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047795 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74081.1| ubiquinol--cytochrome-c reductase subunit 6 [Rhiz... 118 2e-31 dbj|GBC35381.1| ubiquinol-cytochrome c reductase subunit 6 [Rhiz... 113 2e-29 gb|EXX74082.1| hypothetical protein RirG_054330 [Rhizophagus irr... 104 4e-26 gb|ORX66385.1| Non-heme 11 kDa protein of cytochrome bc1 complex... 89 1e-19 gb|KFH67191.1| hypothetical protein MVEG_07714 [Mortierella vert... 86 9e-19 gb|OAQ27087.1| Non-heme 11 kDa protein of cytochrome bc1 complex... 83 2e-17 ref|XP_021880097.1| ubiquinol-cytochrome C reductase hinge domai... 82 3e-17 ref|XP_021883272.1| ubiquinol-cytochrome C reductase hinge domai... 83 1e-16 gb|KWU43339.1| Non-heme 11 kDa protein of cytochrome bc1 complex... 81 2e-16 ref|XP_016276761.1| ubiquinol-cytochrome c reductase complex 17 ... 79 8e-16 gb|POY76855.1| hypothetical protein BMF94_0107 [Rhodotorula taiw... 79 1e-15 gb|ORZ24216.1| ubiquinol-cytochrome C reductase hinge domain-con... 76 2e-15 gb|KXN70458.1| Non-heme 11 kDa protein of cytochrome bc1 complex... 76 6e-15 ref|XP_018272236.1| hypothetical protein RHOBADRAFT_42515 [Rhodo... 77 6e-15 emb|CEQ41452.1| SPOSA6832_03161 [Sporidiobolus salmonicolor] 77 8e-15 emb|CEP12089.1| hypothetical protein [Parasitella parasitica] 75 1e-14 gb|ORZ21421.1| ubiquinol-cytochrome C reductase hinge domain-con... 76 1e-14 gb|EPB85007.1| ubiquinol-cytochrome c reductase subunit 6 [Mucor... 75 1e-14 dbj|GAN04135.1| QCR6 subunit 6 of the ubiquinol cytochrome-c red... 75 1e-14 emb|SAM07690.1| hypothetical protein [Absidia glauca] 74 4e-14 >gb|EXX74081.1| ubiquinol--cytochrome-c reductase subunit 6 [Rhizophagus irregularis DAOM 197198w] gb|PKC06368.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhizophagus irregularis] gb|PKC64053.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhizophagus irregularis] gb|PKK69713.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhizophagus irregularis] Length = 102 Score = 118 bits (295), Expect = 2e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CGETSACKPLKHHLEECTRRVEE GT ENCAEEFLHFMHCVDHCAAPKIFAVLK Sbjct: 49 CGETSACKPLKHHLEECTRRVEESGTGENCAEEFLHFMHCVDHCAAPKIFAVLK 102 >dbj|GBC35381.1| ubiquinol-cytochrome c reductase subunit 6 [Rhizophagus irregularis DAOM 181602] gb|PKY23951.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhizophagus irregularis] gb|PKY49920.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhizophagus irregularis] gb|POG61540.1| hypothetical protein GLOIN_2v1703346 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 100 Score = 113 bits (282), Expect = 2e-29 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFA 355 CGETSACKPLKHHLEECTRRVEE GT ENCAEEFLHFMHCVDHCAAPKIFA Sbjct: 49 CGETSACKPLKHHLEECTRRVEESGTGENCAEEFLHFMHCVDHCAAPKIFA 99 >gb|EXX74082.1| hypothetical protein RirG_054330 [Rhizophagus irregularis DAOM 197198w] Length = 108 Score = 104 bits (260), Expect = 4e-26 Identities = 45/54 (83%), Positives = 46/54 (85%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CGETSACKPLKHHLEECTRRVEE GT ENCAEEFLHFMHCVDHC + F LK Sbjct: 49 CGETSACKPLKHHLEECTRRVEESGTGENCAEEFLHFMHCVDHCVSSMTFVYLK 102 >gb|ORX66385.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Linderina pennispora] Length = 136 Score = 89.0 bits (219), Expect = 1e-19 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CGET ACK LKHHLE C +RVE+G + E+CAEEFLHF+HCVD CA P+IFA LK Sbjct: 84 CGETHACKSLKHHLEACAQRVEDGSS-ESCAEEFLHFLHCVDQCAVPQIFAKLK 136 >gb|KFH67191.1| hypothetical protein MVEG_07714 [Mortierella verticillata NRRL 6337] Length = 102 Score = 85.9 bits (211), Expect = 9e-19 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVL 361 CGE+SAC PLKHHLEECTRRV+E G E+C EE HF+HCV+ CA PK ++ L Sbjct: 49 CGESSACAPLKHHLEECTRRVQEDGAHEDCTEELYHFLHCVNDCAVPKYWSKL 101 >gb|OAQ27087.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Mortierella elongata AG-77] Length = 104 Score = 82.8 bits (203), Expect = 2e-17 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIF 352 CGETSAC PLKHHLEECT+RVE+ G E+C EE HF+HCV+ CA PK F Sbjct: 52 CGETSACAPLKHHLEECTKRVED-GAHEDCIEELYHFLHCVNECAVPKYF 100 >ref|XP_021880097.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Lobosporangium transversale] gb|ORZ12478.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Lobosporangium transversale] Length = 102 Score = 82.0 bits (201), Expect = 3e-17 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIF 352 CGE +AC PLKHHLEEC RRV+E G E+C EE HF+HCV+ CA PK F Sbjct: 49 CGEDAACLPLKHHLEECNRRVQEDGAHEDCIEELYHFLHCVNDCAVPKYF 98 >ref|XP_021883272.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Lobosporangium transversale] gb|ORZ22718.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Lobosporangium transversale] Length = 181 Score = 82.8 bits (203), Expect = 1e-16 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIF 352 C ET+AC LKHHL+ECTRRVEE G E+C EE HF+HCV+ CAAPK F Sbjct: 128 CAETAACTKLKHHLDECTRRVEEEGAHEDCIEELYHFLHCVNECAAPKYF 177 >gb|KWU43339.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Rhodotorula sp. JG-1b] Length = 145 Score = 81.3 bits (199), Expect = 2e-16 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGT---DENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CG+T ACK HHLEEC R+ EG T +E C EE H+MHCVD CAAPKIFA LK Sbjct: 89 CGQTKACKTFLHHLEECGERLAEGKTIVQNETCVEELFHYMHCVDECAAPKIFAALK 145 >ref|XP_016276761.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Rhodotorula toruloides NP11] gb|EMS25642.1| ubiquinol-cytochrome c reductase complex 17 kd protein [Rhodotorula toruloides NP11] emb|CDR37899.1| RHTO0S03e00782g1_1 [Rhodotorula toruloides] gb|PRQ73005.1| Ubiquinol-cytochrome C reductase hinge protein-domain containing protein [Rhodotorula toruloides] Length = 136 Score = 79.3 bits (194), Expect = 8e-16 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGT---DENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CG T CK KHHLEEC R+ G T +E C EE H+MHCVD CAAPKIFA LK Sbjct: 80 CGNTKVCKEFKHHLEECGERLAAGKTIVPNETCVEELFHYMHCVDECAAPKIFAALK 136 >gb|POY76855.1| hypothetical protein BMF94_0107 [Rhodotorula taiwanensis] Length = 159 Score = 79.3 bits (194), Expect = 1e-15 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGT---DENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CG+T ACK HHLEEC R+ +G T E C EE H+MHCVD CAAPKIFA LK Sbjct: 103 CGQTKACKTFLHHLEECGERLADGKTIVPGETCVEELFHYMHCVDECAAPKIFAALK 159 >gb|ORZ24216.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Absidia repens] Length = 54 Score = 75.9 bits (185), Expect = 2e-15 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = +2 Query: 221 CKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 C LKHHL+EC RVE G + ENC EEF HFMHC D CAAPKIFA K Sbjct: 8 CPSLKHHLDECNERVENGSS-ENCIEEFFHFMHCADECAAPKIFATTK 54 >gb|KXN70458.1| Non-heme 11 kDa protein of cytochrome bc1 complex [Conidiobolus coronatus NRRL 28638] Length = 95 Score = 75.9 bits (185), Expect = 6e-15 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 C ET C P KHH +EC RV G + E C EEF H+MHCVD CAAPK+F+ LK Sbjct: 43 CSETKECAPAKHHWQECEERVANGSS-ETCVEEFFHYMHCVDTCAAPKLFSELK 95 >ref|XP_018272236.1| hypothetical protein RHOBADRAFT_42515 [Rhodotorula graminis WP1] gb|KPV76187.1| hypothetical protein RHOBADRAFT_42515 [Rhodotorula graminis WP1] Length = 137 Score = 77.0 bits (188), Expect = 6e-15 Identities = 34/57 (59%), Positives = 36/57 (63%), Gaps = 3/57 (5%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGT---DENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CG T CK KHH EEC RV G T E C EE H+MHCV+ CAAPKIFA LK Sbjct: 81 CGNTKVCKEFKHHFEECGERVAAGNTIIDGETCVEELFHYMHCVEDCAAPKIFAALK 137 >emb|CEQ41452.1| SPOSA6832_03161 [Sporidiobolus salmonicolor] Length = 164 Score = 77.4 bits (189), Expect = 8e-15 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = +2 Query: 203 CGETSACKPLKHHLEECTRRVEEGGT---DENCAEEFLHFMHCVDHCAAPKIFAVLK 364 CG+T C KHHLEEC R+ G T E C EE H+MHCVD CAAPKIFA LK Sbjct: 108 CGQTKVCASFKHHLEECGERLARGETIVHGETCVEELFHYMHCVDECAAPKIFAALK 164 >emb|CEP12089.1| hypothetical protein [Parasitella parasitica] Length = 105 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = +2 Query: 212 TSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 T C LKHHL+EC RVE G + ENC EEF HFMHC D CAAPKI A K Sbjct: 56 TEKCSALKHHLDECNERVENGSS-ENCIEEFFHFMHCADECAAPKIMAATK 105 >gb|ORZ21421.1| ubiquinol-cytochrome C reductase hinge domain-containing protein [Absidia repens] Length = 121 Score = 75.9 bits (185), Expect = 1e-14 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = +2 Query: 221 CKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 C LKHHL+EC RVE G + ENC EEF HFMHC D CAAPKIFA K Sbjct: 75 CPSLKHHLDECNERVENGSS-ENCIEEFFHFMHCADECAAPKIFATTK 121 >gb|EPB85007.1| ubiquinol-cytochrome c reductase subunit 6 [Mucor circinelloides f. circinelloides 1006PhL] Length = 110 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = +2 Query: 212 TSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 T C LKHHL+EC RVE G + ENC EEF HFMHC D CAAPKI A K Sbjct: 61 TEECSALKHHLDECNERVENGSS-ENCIEEFFHFMHCADECAAPKIMAATK 110 >dbj|GAN04135.1| QCR6 subunit 6 of the ubiquinol cytochrome-c reductase complex [Mucor ambiguus] gb|OAC99800.1| hypothetical protein MUCCIDRAFT_113242 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 111 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = +2 Query: 212 TSACKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 T C LKHHL+EC RVE G + ENC EEF HFMHC D CAAPKI A K Sbjct: 62 TEECSALKHHLDECNERVENGSS-ENCIEEFFHFMHCADECAAPKIMAATK 111 >emb|SAM07690.1| hypothetical protein [Absidia glauca] Length = 105 Score = 73.9 bits (180), Expect = 4e-14 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +2 Query: 221 CKPLKHHLEECTRRVEEGGTDENCAEEFLHFMHCVDHCAAPKIFAVLK 364 C LKHHL+EC RVE G + ENC EEF H+MHC D CAAPK+FA K Sbjct: 59 CPSLKHHLDECNERVENGSS-ENCIEEFFHYMHCADECAAPKLFATTK 105