BLASTX nr result
ID: Ophiopogon27_contig00047345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047345 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX70152.1| hypothetical protein RirG_089960 [Rhizophagus irr... 72 5e-12 gb|PKK76999.1| hypothetical protein RhiirC2_771844 [Rhizophagus ... 72 5e-12 dbj|GBC20220.1| hypothetical protein RIR_0763900 [Rhizophagus ir... 72 5e-12 dbj|GBC20219.1| hypothetical protein RIR_0763900 [Rhizophagus ir... 72 5e-12 >gb|EXX70152.1| hypothetical protein RirG_089960 [Rhizophagus irregularis DAOM 197198w] dbj|GBC20221.1| hypothetical protein RIR_0763900 [Rhizophagus irregularis DAOM 181602] gb|PKY42008.1| hypothetical protein RhiirA4_441677 [Rhizophagus irregularis] Length = 376 Score = 71.6 bits (174), Expect = 5e-12 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -1 Query: 199 MVKSSRQKLKRRFRNF--TPSSNNT--PTDQQKNNVSANKVSMLLDKKRNEVQFNNGSAS 32 MVKSSRQK K++ R TP+ N P DQ+ ++ S N+VS LLDK R E +FNNG+AS Sbjct: 1 MVKSSRQKFKQKLRKSITTPAFRNNYIPADQKNHDESTNQVSTLLDKLRKEARFNNGTAS 60 Query: 31 VNFSPTLPQP 2 N S TLPQP Sbjct: 61 ANISSTLPQP 70 >gb|PKK76999.1| hypothetical protein RhiirC2_771844 [Rhizophagus irregularis] Length = 397 Score = 71.6 bits (174), Expect = 5e-12 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -1 Query: 199 MVKSSRQKLKRRFRNF--TPSSNNT--PTDQQKNNVSANKVSMLLDKKRNEVQFNNGSAS 32 MVKSSRQK K++ R TP+ N P DQ+ ++ S N+VS LLDK R E +FNNG+AS Sbjct: 1 MVKSSRQKFKQKLRKSITTPAFRNNYIPADQKNHDESTNQVSTLLDKLRKEARFNNGTAS 60 Query: 31 VNFSPTLPQP 2 N S TLPQP Sbjct: 61 ANISSTLPQP 70 >dbj|GBC20220.1| hypothetical protein RIR_0763900 [Rhizophagus irregularis DAOM 181602] gb|PKY14550.1| hypothetical protein RhiirB3_426563 [Rhizophagus irregularis] Length = 397 Score = 71.6 bits (174), Expect = 5e-12 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -1 Query: 199 MVKSSRQKLKRRFRNF--TPSSNNT--PTDQQKNNVSANKVSMLLDKKRNEVQFNNGSAS 32 MVKSSRQK K++ R TP+ N P DQ+ ++ S N+VS LLDK R E +FNNG+AS Sbjct: 1 MVKSSRQKFKQKLRKSITTPAFRNNYIPADQKNHDESTNQVSTLLDKLRKEARFNNGTAS 60 Query: 31 VNFSPTLPQP 2 N S TLPQP Sbjct: 61 ANISSTLPQP 70 >dbj|GBC20219.1| hypothetical protein RIR_0763900 [Rhizophagus irregularis DAOM 181602] gb|POG60974.1| hypothetical protein GLOIN_2v1708236 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 406 Score = 71.6 bits (174), Expect = 5e-12 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -1 Query: 199 MVKSSRQKLKRRFRNF--TPSSNNT--PTDQQKNNVSANKVSMLLDKKRNEVQFNNGSAS 32 MVKSSRQK K++ R TP+ N P DQ+ ++ S N+VS LLDK R E +FNNG+AS Sbjct: 1 MVKSSRQKFKQKLRKSITTPAFRNNYIPADQKNHDESTNQVSTLLDKLRKEARFNNGTAS 60 Query: 31 VNFSPTLPQP 2 N S TLPQP Sbjct: 61 ANISSTLPQP 70