BLASTX nr result
ID: Ophiopogon27_contig00047339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047339 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK70766.1| kinase-like protein [Rhizophagus irregularis] 84 4e-16 dbj|GBC36176.1| Serine/threonine kinase 32 [Rhizophagus irregula... 84 9e-16 gb|PKY44630.1| kinase-like protein [Rhizophagus irregularis] 84 9e-16 gb|EXX71246.1| Tpk3p [Rhizophagus irregularis DAOM 197198w] >gi|... 84 9e-16 ref|XP_021880314.1| kinase-like domain-containing protein [Lobos... 79 2e-14 gb|OAQ36780.1| kinase-like protein [Mortierella elongata AG-77] 79 5e-14 gb|KFH64054.1| AGC/YANK protein kinase [Mortierella verticillata... 78 7e-14 gb|OAQ36139.1| kinase-like protein, partial [Mortierella elongat... 77 1e-13 ref|XP_016607934.1| AGC/YANK protein kinase [Spizellomyces punct... 74 3e-12 gb|KFH72166.1| AGC/YANK protein kinase [Mortierella verticillata... 73 5e-12 ref|XP_018282182.1| kinase-like protein [Cutaneotrichosporon ole... 72 6e-12 gb|KNE70908.1| AGC/YANK protein kinase [Allomyces macrogynus ATC... 72 9e-12 gb|ORY00492.1| AGC/YANK protein kinase, partial [Basidiobolus me... 72 1e-11 ref|XP_021882812.1| kinase-like domain-containing protein [Lobos... 72 1e-11 gb|KNE57157.1| AGC/YANK protein kinase [Allomyces macrogynus ATC... 72 1e-11 ref|XP_021873671.1| putative camp-dependent protein kinase [Kock... 70 3e-11 gb|ORY03171.1| putative camp-dependent protein kinase [Basidiobo... 70 6e-11 gb|ODN95157.1| AGC/YANK protein kinase [Cryptococcus depauperatu... 69 8e-11 gb|ODN88027.1| AGC/YANK protein kinase [Cryptococcus depauperatu... 69 8e-11 gb|ORZ37667.1| kinase-like domain-containing protein [Catenaria ... 69 8e-11 >gb|PKK70766.1| kinase-like protein [Rhizophagus irregularis] Length = 344 Score = 83.6 bits (205), Expect = 4e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 39 >dbj|GBC36176.1| Serine/threonine kinase 32 [Rhizophagus irregularis DAOM 181602] gb|POG81302.1| kinase-like domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 676 Score = 83.6 bits (205), Expect = 9e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 39 >gb|PKY44630.1| kinase-like protein [Rhizophagus irregularis] Length = 735 Score = 83.6 bits (205), Expect = 9e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 39 >gb|EXX71246.1| Tpk3p [Rhizophagus irregularis DAOM 197198w] gb|PKC09665.1| kinase-like protein [Rhizophagus irregularis] gb|PKC67746.1| kinase-like protein [Rhizophagus irregularis] gb|PKY17689.1| kinase-like protein [Rhizophagus irregularis] Length = 735 Score = 83.6 bits (205), Expect = 9e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 39 >ref|XP_021880314.1| kinase-like domain-containing protein [Lobosporangium transversale] gb|ORZ12965.1| kinase-like domain-containing protein [Lobosporangium transversale] Length = 347 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEE IDFD E+ELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEAIDFDGEIELSHFHLLRSVGKGAFGKVRVV 39 >gb|OAQ36780.1| kinase-like protein [Mortierella elongata AG-77] Length = 745 Score = 78.6 bits (192), Expect = 5e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEE IDF+AE+ELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEVIDFNAEIELSHFHLLRSVGKGAFGKVRVV 39 >gb|KFH64054.1| AGC/YANK protein kinase [Mortierella verticillata NRRL 6337] Length = 766 Score = 78.2 bits (191), Expect = 7e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEE IDF AE+ELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEEAIDFTAEIELSHFHLLRSVGKGAFGKVRVV 39 >gb|OAQ36139.1| kinase-like protein, partial [Mortierella elongata AG-77] Length = 359 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCKEE IDF +E+ELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKEETIDFTSEIELSHFHLLRSVGKGAFGKVRVV 39 >ref|XP_016607934.1| AGC/YANK protein kinase [Spizellomyces punctatus DAOM BR117] gb|KNC99894.1| AGC/YANK protein kinase [Spizellomyces punctatus DAOM BR117] Length = 459 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKEEEIDF EVEL+HFHLLRSVGKGAFGKVRVV Sbjct: 1 MGIACCKEEEIDFTQEVELNHFHLLRSVGKGAFGKVRVV 39 >gb|KFH72166.1| AGC/YANK protein kinase [Mortierella verticillata NRRL 6337] Length = 757 Score = 72.8 bits (177), Expect = 5e-12 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKEE IDF E+ELSHFHLLRSVGKGAFGKVRVV Sbjct: 1 MGVACCKEEAIDFTGEIELSHFHLLRSVGKGAFGKVRVV 39 >ref|XP_018282182.1| kinase-like protein [Cutaneotrichosporon oleaginosum] gb|KLT45691.1| kinase-like protein [Cutaneotrichosporon oleaginosum] Length = 444 Score = 72.4 bits (176), Expect = 6e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCK E IDFDAEV L HF+LLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKPEAIDFDAEVNLFHFYLLRSVGKGAFGKVRVV 39 >gb|KNE70908.1| AGC/YANK protein kinase [Allomyces macrogynus ATCC 38327] Length = 344 Score = 71.6 bits (174), Expect = 9e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKEEEIDFD EV+L+HF LLRSVGKGAFGKVRVV Sbjct: 1 MGGVCCKEEEIDFDGEVDLNHFELLRSVGKGAFGKVRVV 39 >gb|ORY00492.1| AGC/YANK protein kinase, partial [Basidiobolus meristosporus CBS 931.73] Length = 354 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGA CC+EEEIDF EVELSHF+LLRSVGKGAFGKVR+V Sbjct: 1 MGAVCCREEEIDFTTEVELSHFNLLRSVGKGAFGKVRIV 39 >ref|XP_021882812.1| kinase-like domain-containing protein [Lobosporangium transversale] gb|ORZ20903.1| kinase-like domain-containing protein [Lobosporangium transversale] Length = 365 Score = 71.6 bits (174), Expect = 1e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKE+ IDF++E+ELSHFHLLRSVGKG+FGKVRVV Sbjct: 1 MGVSCCKEDAIDFNSEIELSHFHLLRSVGKGSFGKVRVV 39 >gb|KNE57157.1| AGC/YANK protein kinase [Allomyces macrogynus ATCC 38327] Length = 441 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKEEEIDFD EV+L+HF LLRSVGKGAFGKVRVV Sbjct: 1 MGGVCCKEEEIDFDGEVDLNHFELLRSVGKGAFGKVRVV 39 >ref|XP_021873671.1| putative camp-dependent protein kinase [Kockovaella imperatae] gb|ORX39886.1| putative camp-dependent protein kinase [Kockovaella imperatae] Length = 418 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCK E IDFD EV L HF+LLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKPEAIDFDGEVTLFHFYLLRSVGKGAFGKVRVV 39 >gb|ORY03171.1| putative camp-dependent protein kinase [Basidiobolus meristosporus CBS 931.73] Length = 459 Score = 69.7 bits (169), Expect = 6e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGA CCKEEEIDF EVEL HF+LLRSVGKGAFGKVR+V Sbjct: 1 MGALCCKEEEIDFSNEVELYHFNLLRSVGKGAFGKVRIV 39 >gb|ODN95157.1| AGC/YANK protein kinase [Cryptococcus depauperatus CBS 7855] Length = 433 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCK E IDF+ EV L HF+LLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKPEAIDFEGEVNLFHFYLLRSVGKGAFGKVRVV 39 >gb|ODN88027.1| AGC/YANK protein kinase [Cryptococcus depauperatus CBS 7841] Length = 433 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MGAGCCK E IDF+ EV L HF+LLRSVGKGAFGKVRVV Sbjct: 1 MGAGCCKPEAIDFEGEVNLFHFYLLRSVGKGAFGKVRVV 39 >gb|ORZ37667.1| kinase-like domain-containing protein [Catenaria anguillulae PL171] Length = 459 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 119 MGAGCCKEEEIDFDAEVELSHFHLLRSVGKGAFGKVRVV 3 MG CCKEE IDFD EV+L+HF LLRSVGKGAFGKVRVV Sbjct: 1 MGGVCCKEETIDFDGEVDLNHFELLRSVGKGAFGKVRVV 39