BLASTX nr result
ID: Ophiopogon27_contig00047273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00047273 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC10753.1| hypothetical protein RhiirA5_355138, partial [Rhi... 84 1e-16 gb|EXX71802.1| hypothetical protein RirG_075180 [Rhizophagus irr... 86 1e-16 >gb|PKC10753.1| hypothetical protein RhiirA5_355138, partial [Rhizophagus irregularis] Length = 245 Score = 83.6 bits (205), Expect = 1e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 449 LWLDTVKVMTAGIIEMENDIEELERQRASERATKPWTIHY 330 LWLDTVK++TAG+IEMENDIEELERQRASERATKPWTIHY Sbjct: 206 LWLDTVKILTAGVIEMENDIEELERQRASERATKPWTIHY 245 >gb|EXX71802.1| hypothetical protein RirG_075180 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41597.1| hypothetical protein RIR_2495500 [Rhizophagus irregularis DAOM 181602] gb|PKC71807.1| hypothetical protein RhiirA1_390251 [Rhizophagus irregularis] gb|PKK78243.1| hypothetical protein RhiirC2_843673 [Rhizophagus irregularis] gb|PKY19423.1| hypothetical protein RhiirB3_469158 [Rhizophagus irregularis] gb|PKY46228.1| hypothetical protein RhiirA4_444202 [Rhizophagus irregularis] gb|POG80103.1| hypothetical protein GLOIN_2v1835934 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 404 Score = 85.5 bits (210), Expect = 1e-16 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 449 LWLDTVKVMTAGIIEMENDIEELERQRASERATKPWTIHYK 327 LWLDTVK++TAG+IEMENDIEELERQRASERATKPWTIHYK Sbjct: 364 LWLDTVKILTAGVIEMENDIEELERQRASERATKPWTIHYK 404