BLASTX nr result
ID: Ophiopogon27_contig00046528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046528 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ORX92142.1| hypothetical protein K493DRAFT_338970 [Basidiobol... 56 3e-07 gb|ORX91160.1| hypothetical protein K493DRAFT_304292 [Basidiobol... 54 2e-06 >gb|ORX92142.1| hypothetical protein K493DRAFT_338970 [Basidiobolus meristosporus CBS 931.73] Length = 150 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +2 Query: 203 STVAGHGHMIFPPIRIPPGDQNNGLTLTRAPNPG-PCARLKPGPIKKTFS 349 + V HGHM P +RIPPGD+N GL+LTR PN PC PGP +S Sbjct: 16 ANVMAHGHMTVPEVRIPPGDRNVGLSLTRGPNSHMPCGGNPPGPTTARYS 65 >gb|ORX91160.1| hypothetical protein K493DRAFT_304292 [Basidiobolus meristosporus CBS 931.73] Length = 153 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 209 VAGHGHMIFPPIRIPPGDQNNGLTLTRAPNPG-PCARLKPGPIKKTF 346 VA HGHM P +R PPGD+ NGLT+TR PN PC PG T+ Sbjct: 21 VATHGHMTSPEVRTPPGDKGNGLTITRGPNNNMPCGGNPPGKPSTTY 67