BLASTX nr result
ID: Ophiopogon27_contig00046509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046509 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus ir... 155 6e-46 gb|PKK76579.1| hypothetical protein RhiirC2_733879 [Rhizophagus ... 58 2e-08 >dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus irregularis DAOM 181602] gb|PKC12801.1| hypothetical protein RhiirA5_352523 [Rhizophagus irregularis] gb|PKC68017.1| hypothetical protein RhiirA1_417379 [Rhizophagus irregularis] gb|PKY18041.1| hypothetical protein RhiirB3_405039 [Rhizophagus irregularis] gb|PKY38324.1| hypothetical protein RhiirA4_391803 [Rhizophagus irregularis] Length = 99 Score = 155 bits (392), Expect = 6e-46 Identities = 71/81 (87%), Positives = 72/81 (88%) Frame = -3 Query: 459 MSQMPEGDDDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREXXXXXXXXXGYDESFFPS 280 MSQMPEGDDDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMRE GY+ESFFPS Sbjct: 1 MSQMPEGDDDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREGSSHHGHHGGYEESFFPS 60 Query: 279 PHPHHKGGAHHRQNQQGDKTV 217 PHPHHKGGAHHRQNQQGDKTV Sbjct: 61 PHPHHKGGAHHRQNQQGDKTV 81 >gb|PKK76579.1| hypothetical protein RhiirC2_733879 [Rhizophagus irregularis] Length = 54 Score = 58.2 bits (139), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 287 FQVLIHIIKVALIIDKINKEIKRWIKIF 204 FQVLIHIIKVALIIDKINKEIKRWIKIF Sbjct: 12 FQVLIHIIKVALIIDKINKEIKRWIKIF 39