BLASTX nr result
ID: Ophiopogon27_contig00046461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046461 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG77622.1| hypothetical protein GLOIN_2v1546150, partial [Rh... 100 6e-25 gb|PKB96713.1| hypothetical protein RhiirA5_367679, partial [Rhi... 75 6e-15 gb|PKB94093.1| hypothetical protein RhiirA5_439564 [Rhizophagus ... 64 2e-10 >gb|POG77622.1| hypothetical protein GLOIN_2v1546150, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 56 Score = 100 bits (249), Expect = 6e-25 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = -1 Query: 482 PLKLHPTLSKEMISKPPDVDQFWDTPLPPRNTPKSRRQKRKTRKIHQKIRKN 327 PLKLHPTLSKE I KPPDVDQFWDTPLPPR TPKSRRQKRK RKIHQK +KN Sbjct: 4 PLKLHPTLSKEKIYKPPDVDQFWDTPLPPRKTPKSRRQKRKMRKIHQKNKKN 55 >gb|PKB96713.1| hypothetical protein RhiirA5_367679, partial [Rhizophagus irregularis] Length = 75 Score = 75.5 bits (184), Expect = 6e-15 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = -1 Query: 482 PLKLHPTLSKEMISKPPDVDQFWDTPLPPRNTPKSRRQKRKTRKIHQKIRKNH 324 PLKLHPTLSKE I KPPDVDQFWDTP PP K+ +K + K +KIRK H Sbjct: 23 PLKLHPTLSKEKIYKPPDVDQFWDTPYPPEKLQKAEGKKERREKFTKKIRKIH 75 >gb|PKB94093.1| hypothetical protein RhiirA5_439564 [Rhizophagus irregularis] Length = 82 Score = 64.3 bits (155), Expect = 2e-10 Identities = 36/87 (41%), Positives = 43/87 (49%) Frame = -1 Query: 407 PLPPRNTPKSRRQKRKTRKIHQKIRKNHKP*ENQPKGVKT*VKKEISPNYHQERHLIIKK 228 P PP K+ +K + K +KIRK H P + PK +K Sbjct: 9 PYPPEKLQKAEGKKERREKFTKKIRKIHNPRKTNPK----------------------EK 46 Query: 227 RTFTT*QNRNFFLPAWNLQPCRQSHSK 147 RTFTT +N NFFLPAWNLQP QS SK Sbjct: 47 RTFTTERNGNFFLPAWNLQPYNQSRSK 73