BLASTX nr result
ID: Ophiopogon27_contig00046455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046455 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC37355.1| hypothetical protein RIR_2152200 [Rhizophagus ir... 60 3e-12 >dbj|GBC37355.1| hypothetical protein RIR_2152200 [Rhizophagus irregularis DAOM 181602] Length = 85 Score = 60.5 bits (145), Expect(2) = 3e-12 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -3 Query: 168 TI*WSCLCRSIKNLNYFIINSCYYSQFLTLNHSYHFTNIY 49 TI W CLCRSIKNLNYFIINSCYY QFL F+ I+ Sbjct: 10 TILWPCLCRSIKNLNYFIINSCYYFQFLIFESFLPFSQIF 49 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 59 QIFINRLSLIIKLINHASI 3 QIFINRLSLIIKLINHASI Sbjct: 47 QIFINRLSLIIKLINHASI 65