BLASTX nr result
ID: Ophiopogon27_contig00046430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046430 (630 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK61104.1| hypothetical protein RhiirC2_792309 [Rhizophagus ... 87 8e-19 >gb|PKK61104.1| hypothetical protein RhiirC2_792309 [Rhizophagus irregularis] Length = 79 Score = 86.7 bits (213), Expect = 8e-19 Identities = 55/100 (55%), Positives = 57/100 (57%) Frame = -2 Query: 629 ARTQIYNEMEPYLLVLLRESICAR*QKLKIFILCSKE*EEIK*SVFTRM*STSNENVSSA 450 ARTQIY+EME L+ I R NENVSSA Sbjct: 13 ARTQIYHEME-----LISPGIIKR----------------------------DNENVSSA 39 Query: 449 TQAPMKSPKASKALPRLFRLCKKLLKGKHEREEVIYSGLN 330 QAPMKSPKASKALPRL RLCKKLLKG HEREEVIYS LN Sbjct: 40 AQAPMKSPKASKALPRLSRLCKKLLKGNHEREEVIYSFLN 79