BLASTX nr result
ID: Ophiopogon27_contig00046401
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046401 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63191.1| hypothetical protein 20.t00043 [Asparagus officin... 72 2e-12 >gb|ABD63191.1| hypothetical protein 20.t00043 [Asparagus officinalis] Length = 316 Score = 72.4 bits (176), Expect = 2e-12 Identities = 43/94 (45%), Positives = 54/94 (57%), Gaps = 1/94 (1%) Frame = -1 Query: 385 VESLVSEFDQAKFQEYLSLASSRGVTSRKCRKVVHEPNFKQARVVLPECSVWAFTWGSIP 206 VESL+ EFDQAK++EYLS +SS G SRKC +VV + A +PE S A GSI Sbjct: 28 VESLIIEFDQAKYKEYLSTSSSNGNASRKCHRVVRVTRPQVAEASMPEDSTRAMAGGSIS 87 Query: 205 PKVVSPSFKA*HTVWKATRWV-AKQPAQAEVSQE 107 PK+V+ T K RW A+ AQA S + Sbjct: 88 PKLVNAKQNTKSTERKTARWAFARSEAQAFASYD 121