BLASTX nr result
ID: Ophiopogon27_contig00046271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046271 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC35585.1| hypothetical protein RIR_2014300 [Rhizophagus ir... 55 6e-06 gb|PKY47039.1| hypothetical protein RhiirA4_444640 [Rhizophagus ... 55 6e-06 gb|PKB95616.1| hypothetical protein RhiirA5_436384, partial [Rhi... 55 6e-06 gb|PKY32377.1| hypothetical protein RhiirB3_532040 [Rhizophagus ... 55 6e-06 >dbj|GBC35585.1| hypothetical protein RIR_2014300 [Rhizophagus irregularis DAOM 181602] Length = 445 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +1 Query: 313 DWTAPVKKLCRMNRIYRKVELMQAKQQLLNLIKHVNHIDVFQKQFVVSSR 462 +WT PVKK+ + NR Y+K+ +++ KQQL + N ID+FQKQF+ S+ Sbjct: 52 NWTVPVKKIYKSNRTYKKIGVVRVKQQLNAIKNSANQIDIFQKQFIYDSQ 101 >gb|PKY47039.1| hypothetical protein RhiirA4_444640 [Rhizophagus irregularis] Length = 468 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +1 Query: 313 DWTAPVKKLCRMNRIYRKVELMQAKQQLLNLIKHVNHIDVFQKQFVVSSR 462 +WT PVKK+ + NR Y+K+ +++ KQQL + N ID+FQKQF+ S+ Sbjct: 69 NWTVPVKKIYKSNRTYKKIGVVRVKQQLNAIKNSANQIDIFQKQFIYDSQ 118 >gb|PKB95616.1| hypothetical protein RhiirA5_436384, partial [Rhizophagus irregularis] gb|PKC54244.1| hypothetical protein RhiirA1_477698, partial [Rhizophagus irregularis] Length = 525 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +1 Query: 313 DWTAPVKKLCRMNRIYRKVELMQAKQQLLNLIKHVNHIDVFQKQFVVSSR 462 +WT PVKK+ + NR Y+K+ +++ KQQL + N ID+FQKQF+ S+ Sbjct: 1 NWTVPVKKIYKSNRTYKKIGVVRVKQQLNAIKNSANQIDIFQKQFIYDSQ 50 >gb|PKY32377.1| hypothetical protein RhiirB3_532040 [Rhizophagus irregularis] Length = 593 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +1 Query: 313 DWTAPVKKLCRMNRIYRKVELMQAKQQLLNLIKHVNHIDVFQKQFVVSSR 462 +WT PVKK+ + NR Y+K+ +++ KQQL + N ID+FQKQF+ S+ Sbjct: 69 NWTVPVKKIYKSNRTYKKIGVVRVKQQLNAIKNSANQIDIFQKQFIYDSQ 118