BLASTX nr result
ID: Ophiopogon27_contig00046213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046213 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_013376736.1| lytic transglycosylase domain-containing pro... 144 1e-39 gb|EAU68488.1| type III helper protein HopP1 [Stigmatella aurant... 144 4e-39 ref|WP_083968822.1| lytic transglycosylase domain-containing pro... 140 1e-38 ref|WP_075006788.1| lytic transglycosylase domain-containing pro... 140 3e-38 ref|WP_093516273.1| lytic transglycosylase domain-containing pro... 140 3e-38 ref|WP_014394602.1| lytic transglycosylase domain-containing pro... 140 4e-38 ref|WP_074951156.1| lytic transglycosylase domain-containing pro... 140 4e-38 ref|WP_044191319.1| lytic transglycosylase domain-containing pro... 139 8e-38 ref|WP_095979519.1| lytic transglycosylase domain-containing pro... 133 2e-35 ref|WP_095984089.1| lytic transglycosylase domain-containing pro... 130 7e-35 ref|WP_002623977.1| lytic transglycosylase domain-containing pro... 130 1e-34 ref|WP_007879242.1| lytic transglycosylase domain-containing pro... 128 3e-34 emb|SDX37522.1| Transglycosylase SLT domain-containing protein [... 130 6e-34 ref|WP_011550261.1| lytic transglycosylase domain-containing pro... 130 8e-34 ref|WP_071903719.1| lytic transglycosylase domain-containing pro... 127 1e-33 gb|ATB44557.1| transglycosylase [Myxococcus macrosporus DSM 14697] 129 2e-33 gb|AEI63547.1| transglycosylase SLT domain-containing protein [M... 129 2e-33 ref|WP_002637719.1| lytic transglycosylase domain-containing pro... 129 2e-33 ref|WP_095956638.1| lytic transglycosylase domain-containing pro... 129 2e-33 ref|WP_043709707.1| lytic transglycosylase domain-containing pro... 129 2e-33 >ref|WP_013376736.1| lytic transglycosylase domain-containing protein [Stigmatella aurantiaca] gb|ADO73101.1| Lytic transglycosylase [Stigmatella aurantiaca DW4/3-1] Length = 311 Score = 144 bits (362), Expect = 1e-39 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 ++K I++ + K VPA++ A QIWQESR N A+S NG DTGLMQIN NTF E++ Sbjct: 166 QYKGAIESAASKAGVPASMLAGQIWQESRGNLGATSTNGGNGLTDTGLMQINPNTFGELQ 225 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N +DP TNIL G+FY+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 226 SKHPELQGKNLSDPETNILAGAFYMKDMKEQFGNWDLALRAYNSGPNGVDRSNPNAIPAG 285 Query: 348 VGDPNYVRLV 377 GD YV+ V Sbjct: 286 TGDATYVQKV 295 >gb|EAU68488.1| type III helper protein HopP1 [Stigmatella aurantiaca DW4/3-1] Length = 372 Score = 144 bits (362), Expect = 4e-39 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 ++K I++ + K VPA++ A QIWQESR N A+S NG DTGLMQIN NTF E++ Sbjct: 227 QYKGAIESAASKAGVPASMLAGQIWQESRGNLGATSTNGGNGLTDTGLMQINPNTFGELQ 286 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N +DP TNIL G+FY+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 287 SKHPELQGKNLSDPETNILAGAFYMKDMKEQFGNWDLALRAYNSGPNGVDRSNPNAIPAG 346 Query: 348 VGDPNYVRLV 377 GD YV+ V Sbjct: 347 TGDATYVQKV 356 >ref|WP_083968822.1| lytic transglycosylase domain-containing protein [Hyalangium minutum] gb|KFE64721.1| Soluble lytic murein transglycosylase [Hyalangium minutum] Length = 289 Score = 140 bits (354), Expect = 1e-38 Identities = 71/130 (54%), Positives = 92/130 (70%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 ++K+ I++ + KT VPA++ AAQIWQESR N A+S NG DTGLMQ+N NTF E++ Sbjct: 144 QYKNAIESAAAKTGVPASMLAAQIWQESRGNLGATSTNGGNGLTDTGLMQMNPNTFKELQ 203 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ E+ G N DP TNIL G++Y+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 204 GKYPELQGKNLADPETNILAGAYYMKDMKEQFGNWDLALRAYNSGPNGVDRSNPNAIPAG 263 Query: 348 VGDPNYVRLV 377 GD YV+ V Sbjct: 264 TGDATYVQKV 273 >ref|WP_075006788.1| lytic transglycosylase domain-containing protein [Stigmatella aurantiaca] emb|SEL45188.1| Transglycosylase SLT domain-containing protein [Stigmatella aurantiaca] Length = 312 Score = 140 bits (352), Expect = 3e-38 Identities = 70/130 (53%), Positives = 89/130 (68%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 ++K I++ + K VPA++ AAQIWQESR + A++ NG DTGLMQ+N NTF E++ Sbjct: 167 KYKGAIESAAAKAGVPASMLAAQIWQESRGDLGAATTNGGNGLTDTGLMQVNPNTFQELQ 226 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N DP TNIL G+FY+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 227 SKHPELQGKNLADPETNILAGAFYMKDMKEQFGSWDLALRAYNSGPNGVDRSNPNAIPAG 286 Query: 348 VGDPNYVRLV 377 GD YV V Sbjct: 287 TGDATYVEKV 296 >ref|WP_093516273.1| lytic transglycosylase domain-containing protein [Stigmatella erecta] emb|SET20573.1| Transglycosylase SLT domain-containing protein [Stigmatella erecta] Length = 312 Score = 140 bits (352), Expect = 3e-38 Identities = 70/130 (53%), Positives = 89/130 (68%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 ++K I++ + K VPA++ AAQIWQESR + A++ NG DTGLMQ+N NTF E++ Sbjct: 167 KYKGAIESAAAKAGVPASMLAAQIWQESRGDLGAATTNGGNGLTDTGLMQVNPNTFQELQ 226 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N DP TNIL G+FY+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 227 SKHPELQGKNLADPETNILAGAFYMKDMKEQFGSWDLALRAYNSGPNGVDRSNPNAIPAG 286 Query: 348 VGDPNYVRLV 377 GD YV V Sbjct: 287 TGDATYVEKV 296 >ref|WP_014394602.1| lytic transglycosylase domain-containing protein [Corallococcus coralloides] gb|AFE11148.1| transglycosylase SLT domain-containing protein [Corallococcus coralloides DSM 2259] Length = 315 Score = 140 bits (352), Expect = 4e-38 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 +F+S I++ S KT +PA + AAQIWQESR N A S NG DTGLMQ+N NT+ E++ Sbjct: 170 KFRSAIESASAKTGMPAEMLAAQIWQESRGNLEAVSTNGGNGLTDTGLMQVNPNTYGELQ 229 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N +DP TNIL G+FY+ +M A+FG LALRAYNSGPN VD S+P+ P G Sbjct: 230 AKHPELQGKNLSDPETNILAGAFYMKDMKAQFGSDELALRAYNSGPNGVDKSNPDAIPAG 289 Query: 348 VGDPNYVRLV 377 GD YV+ V Sbjct: 290 TGDATYVQKV 299 >ref|WP_074951156.1| lytic transglycosylase domain-containing protein [Myxococcus fulvus] emb|SET60323.1| Transglycosylase SLT domain-containing protein [Myxococcus fulvus] Length = 340 Score = 140 bits (353), Expect = 4e-38 Identities = 72/130 (55%), Positives = 92/130 (70%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 +F+S I++ + KT VPA + AAQIWQESR + A + NG KDTGLMQ+N NTF E++ Sbjct: 195 KFRSAIESAAAKTGVPAEMLAAQIWQESRGDLAAVTTNGGNGLKDTGLMQVNPNTFKELQ 254 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G + +DPATNIL G+ Y+ +M +FG W LALRAYNSGPN VD S+P+ P G Sbjct: 255 AKHPELAGKDLSDPATNILAGACYMKDMKEQFGGWDLALRAYNSGPNGVDKSNPDAIPAG 314 Query: 348 VGDPNYVRLV 377 GD YVR V Sbjct: 315 TGDVTYVRKV 324 >ref|WP_044191319.1| lytic transglycosylase domain-containing protein [Hyalangium minutum] gb|KFE67310.1| Soluble lytic murein transglycosylase [Hyalangium minutum] gb|KFE67397.1| Soluble lytic murein transglycosylase [Hyalangium minutum] Length = 336 Score = 139 bits (351), Expect = 8e-38 Identities = 71/130 (54%), Positives = 87/130 (66%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 +FK I++ + K VPA++ A QIWQESR N A + NG DTGLMQ+N NTF E++ Sbjct: 191 QFKGAIESAAAKAGVPASMLAGQIWQESRGNIAAVTTNGGNGLTDTGLMQVNPNTFGELQ 250 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G N DP TNIL G+FY+ +M +FG W LALRAYNSGPN VD S+PN P G Sbjct: 251 AKHPELQGKNLADPETNILAGAFYMKDMKEQFGSWDLALRAYNSGPNGVDKSNPNAIPAG 310 Query: 348 VGDPNYVRLV 377 GD YV V Sbjct: 311 TGDATYVNKV 320 >ref|WP_095979519.1| lytic transglycosylase domain-containing protein [Melittangium boletus] gb|ATB31157.1| hypothetical protein MEBOL_004619 [Melittangium boletus DSM 14713] Length = 333 Score = 133 bits (335), Expect = 2e-35 Identities = 67/127 (52%), Positives = 83/127 (65%), Gaps = 5/127 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 +FK I++ + VPAN+ A QIWQESR N A + NG DTGLMQ+N NTF E++ Sbjct: 188 QFKGAIESAAATAGVPANMLAGQIWQESRGNIAAITTNGGNGLTDTGLMQVNPNTFGELQ 247 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 KH E+ G + DP TNIL G+FY+ +M +FG W LALR YNSGPN VD +DP P G Sbjct: 248 AKHPELQGKDLADPTTNILAGAFYMKDMKEQFGNWDLALRGYNSGPNGVDRNDPRALPAG 307 Query: 348 VGDPNYV 368 GD YV Sbjct: 308 TGDATYV 314 >ref|WP_095984089.1| lytic transglycosylase domain-containing protein [Cystobacter fuscus] gb|ATB35467.1| transglycosylase SLT domain protein [Cystobacter fuscus] Length = 287 Score = 130 bits (328), Expect = 7e-35 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 5/126 (3%) Frame = +3 Query: 6 FKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMRH 173 ++ I++ S +T VPAN+ AAQIWQESR N A S NG DTGLMQ+N NT+ E++ Sbjct: 143 YRGAIESASAETGVPANMLAAQIWQESRGNLAAVSTNGGNGLTDTGLMQVNPNTYGELQA 202 Query: 174 KHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHGV 350 KH + G + +DPA NIL G++Y+ +M +FG W ALRAYNSGPN VD S+ N P G Sbjct: 203 KHPALQGKDLSDPANNILAGAYYMKDMKEQFGDWKTALRAYNSGPNGVDKSNLNALPAGT 262 Query: 351 GDPNYV 368 GD YV Sbjct: 263 GDATYV 268 >ref|WP_002623977.1| lytic transglycosylase domain-containing protein [Cystobacter fuscus] gb|EPX60052.1| transglycosylase SLT domain protein [Cystobacter fuscus DSM 2262] Length = 294 Score = 130 bits (327), Expect = 1e-34 Identities = 66/126 (52%), Positives = 84/126 (66%), Gaps = 5/126 (3%) Frame = +3 Query: 6 FKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMRH 173 ++ I++ S KT VPAN+ AAQIWQESR N A S NG DTGLMQ+N NT+ E++ Sbjct: 150 YRGAIESASAKTGVPANMLAAQIWQESRGNLAAVSTNGGNGLTDTGLMQVNPNTYGELQA 209 Query: 174 KHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHGV 350 KH E+ G + + P NIL G++Y+ +M +FG W ALRAYNSGPN VD S+ N P G Sbjct: 210 KHPELQGKDLSSPENNILAGAYYMKDMKEQFGDWKTALRAYNSGPNGVDKSNLNALPAGT 269 Query: 351 GDPNYV 368 GD YV Sbjct: 270 GDATYV 275 >ref|WP_007879242.1| lytic transglycosylase domain-containing protein [Herbaspirillum sp. CF444] gb|EJL88983.1| soluble lytic murein transglycosylase-like protein [Herbaspirillum sp. CF444] Length = 243 Score = 128 bits (321), Expect = 3e-34 Identities = 71/134 (52%), Positives = 90/134 (67%), Gaps = 10/134 (7%) Frame = +3 Query: 6 FKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNN---GKDTGLMQINDNTFAEMRHK 176 +KS I+ S +T VPA++ A I ESR ASS N G DTGL+Q+NDNTFA ++ K Sbjct: 95 YKSMIEEASRRTGVPASLLAGLIHDESRWQTGASSTNANGGGDTGLVQMNDNTFAALQAK 154 Query: 177 HKEI-GPNKNDPATNILGGSFYLAEMFA----RFG--KWPLALRAYNSGPNSVDPSDPNK 335 H E+ G NKNDPATNIL G++YLA+M + ++G W +ALRAYNSG N VDP + + Sbjct: 155 HPELQGRNKNDPATNILAGAYYLADMKSLMKEKYGVDSWEIALRAYNSGENGVDPHNLSN 214 Query: 336 TPHGVGDPNYVRLV 377 P G GDPNYV V Sbjct: 215 LPAGTGDPNYVTKV 228 >emb|SDX37522.1| Transglycosylase SLT domain-containing protein [Myxococcus xanthus] Length = 353 Score = 130 bits (326), Expect = 6e-34 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + +++ + KT VP + AAQ+W ESR +ASS NG DTGLMQ+N NTF ++ Sbjct: 208 KLRPALESAAAKTGVPVEMLAAQVWAESRGKVDASSTNGGNGMTDTGLMQVNPNTFKGLQ 267 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ E+ G N +DP TNIL G+ Y+ +M A+FG W LALRAYNSGPN VD S+P+ P G Sbjct: 268 DKYPELQGKNLSDPETNILAGACYMKDMKAQFGNWDLALRAYNSGPNGVDKSNPHAIPAG 327 Query: 348 VGDPNYVRLV 377 +G +YVR V Sbjct: 328 LGSADYVRNV 337 >ref|WP_011550261.1| lytic transglycosylase domain-containing protein [Myxococcus xanthus] gb|ABF86219.1| transglycosylase SLT domain protein [Myxococcus xanthus DK 1622] Length = 369 Score = 130 bits (326), Expect = 8e-34 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + +++ + KT VP + AAQ+W ESR +ASS NG DTGLMQ+N NTF ++ Sbjct: 224 KLRPALESAAAKTGVPVEMLAAQVWAESRGKVDASSTNGGNGMTDTGLMQVNPNTFKGLQ 283 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ E+ G N +DP TNIL G+ Y+ +M A+FG W LALRAYNSGPN VD S+P+ P G Sbjct: 284 DKYPELQGKNLSDPETNILAGACYMKDMKAQFGNWDLALRAYNSGPNGVDKSNPHAIPAG 343 Query: 348 VGDPNYVRLV 377 +G +YVR V Sbjct: 344 LGSADYVRNV 353 >ref|WP_071903719.1| lytic transglycosylase domain-containing protein [Cystobacter ferrugineus] gb|OJH35139.1| transglycosylase [Cystobacter ferrugineus] Length = 293 Score = 127 bits (320), Expect = 1e-33 Identities = 65/126 (51%), Positives = 84/126 (66%), Gaps = 5/126 (3%) Frame = +3 Query: 6 FKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMRH 173 ++S I++ S KT VPAN+ A QIWQESR N A S NG DTGLMQ+N NT+ E++ Sbjct: 149 YRSAIESASAKTGVPANMLAGQIWQESRGNLAAVSTNGGNGLTDTGLMQVNPNTYGELQA 208 Query: 174 KHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHGV 350 K+ E+ G + + P NIL G++Y+ +M +FG W ALRAYNSGPN VD S+ N P G Sbjct: 209 KYPELQGKDLSTPENNILAGAYYMKDMKEQFGDWKTALRAYNSGPNGVDKSNLNALPAGT 268 Query: 351 GDPNYV 368 GD YV Sbjct: 269 GDATYV 274 >gb|ATB44557.1| transglycosylase [Myxococcus macrosporus DSM 14697] Length = 371 Score = 129 bits (324), Expect = 2e-33 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + I++ + K VPA + AAQ+W ESR + +A+S NG DTGLMQ+N NTF E++ Sbjct: 226 KLRPLIESAAAKAGVPAEMIAAQVWAESRGDVSATSTNGGNGLTDTGLMQVNPNTFKELQ 285 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ ++ G + +DPATNIL G+FY+ +M +FG LALRAYNSGPN VD S+P+ P G Sbjct: 286 AKYPDLQGKDLSDPATNILAGAFYMKDMKEQFGSIDLALRAYNSGPNGVDKSNPHAIPAG 345 Query: 348 VGDPNYVRLV 377 GD NYV+ V Sbjct: 346 TGDANYVKKV 355 >gb|AEI63547.1| transglycosylase SLT domain-containing protein [Myxococcus fulvus HW-1] Length = 371 Score = 129 bits (324), Expect = 2e-33 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + I++ + K VPA + AAQ+W ESR + +A+S NG DTGLMQ+N NTF E++ Sbjct: 226 KLRPLIESAAAKAGVPAEMIAAQVWAESRGDVSATSTNGGNGLTDTGLMQVNPNTFKELQ 285 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ ++ G + +DPATNIL G+FY+ +M +FG LALRAYNSGPN VD S+P+ P G Sbjct: 286 AKYPDLQGKDLSDPATNILAGAFYMKDMKEQFGSIDLALRAYNSGPNGVDKSNPHAIPAG 345 Query: 348 VGDPNYVRLV 377 GD NYV+ V Sbjct: 346 TGDANYVKKV 355 >ref|WP_002637719.1| lytic transglycosylase domain-containing protein [Myxococcus hansupus] gb|AKQ69992.1| Soluble lytic murein transglycosylase [Myxococcus hansupus] Length = 385 Score = 129 bits (324), Expect = 2e-33 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + I++ + K VPA + AAQ+W ESR + +A+S NG DTGLMQ+N NTF E++ Sbjct: 240 KLRPLIESAAAKAGVPAEMIAAQVWAESRGDVSATSTNGGNGLTDTGLMQVNPNTFKELQ 299 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ ++ G + +DPATNIL G+FY+ +M +FG LALRAYNSGPN VD S+P+ P G Sbjct: 300 AKYPDLQGKDLSDPATNILAGAFYMKDMKEQFGSIDLALRAYNSGPNGVDKSNPHAIPAG 359 Query: 348 VGDPNYVRLV 377 GD NYV+ V Sbjct: 360 TGDANYVKKV 369 >ref|WP_095956638.1| lytic transglycosylase domain-containing protein [Myxococcus macrosporus] Length = 387 Score = 129 bits (324), Expect = 2e-33 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + I++ + K VPA + AAQ+W ESR + +A+S NG DTGLMQ+N NTF E++ Sbjct: 242 KLRPLIESAAAKAGVPAEMIAAQVWAESRGDVSATSTNGGNGLTDTGLMQVNPNTFKELQ 301 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ ++ G + +DPATNIL G+FY+ +M +FG LALRAYNSGPN VD S+P+ P G Sbjct: 302 AKYPDLQGKDLSDPATNILAGAFYMKDMKEQFGSIDLALRAYNSGPNGVDKSNPHAIPAG 361 Query: 348 VGDPNYVRLV 377 GD NYV+ V Sbjct: 362 TGDANYVKKV 371 >ref|WP_043709707.1| lytic transglycosylase domain-containing protein [Myxococcus fulvus] Length = 387 Score = 129 bits (324), Expect = 2e-33 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 5/130 (3%) Frame = +3 Query: 3 RFKSQIQAGSEKTKVPANVTAAQIWQESRANPNASSNNG----KDTGLMQINDNTFAEMR 170 + + I++ + K VPA + AAQ+W ESR + +A+S NG DTGLMQ+N NTF E++ Sbjct: 242 KLRPLIESAAAKAGVPAEMIAAQVWAESRGDVSATSTNGGNGLTDTGLMQVNPNTFKELQ 301 Query: 171 HKHKEI-GPNKNDPATNILGGSFYLAEMFARFGKWPLALRAYNSGPNSVDPSDPNKTPHG 347 K+ ++ G + +DPATNIL G+FY+ +M +FG LALRAYNSGPN VD S+P+ P G Sbjct: 302 AKYPDLQGKDLSDPATNILAGAFYMKDMKEQFGSIDLALRAYNSGPNGVDKSNPHAIPAG 361 Query: 348 VGDPNYVRLV 377 GD NYV+ V Sbjct: 362 TGDANYVKKV 371