BLASTX nr result
ID: Ophiopogon27_contig00046151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046151 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC49273.1| hypothetical protein RIR_3119100 [Rhizophagus ir... 101 2e-25 >dbj|GBC49273.1| hypothetical protein RIR_3119100 [Rhizophagus irregularis DAOM 181602] gb|PKB94685.1| hypothetical protein RhiirA5_368165 [Rhizophagus irregularis] gb|PKC53236.1| hypothetical protein RhiirA1_430132 [Rhizophagus irregularis] gb|PKK66243.1| hypothetical protein RhiirC2_753757 [Rhizophagus irregularis] gb|PKY29627.1| hypothetical protein RhiirB3_418145 [Rhizophagus irregularis] gb|POG75545.1| hypothetical protein GLOIN_2v1872703 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 104 Score = 101 bits (252), Expect = 2e-25 Identities = 57/102 (55%), Positives = 65/102 (63%), Gaps = 4/102 (3%) Frame = +1 Query: 85 MPSA-NGNFSTNVPKTMTEFELLVVXXXXXXXXXXXXXXXXX---LRTKRINCTRTAGTI 252 MPSA N N T++PKTM E+E+LV+ LRTKRINC +T GTI Sbjct: 1 MPSASNNNIPTSLPKTMREYEVLVIPSSPTSPTGQYHQPQPQQPMLRTKRINCNQTNGTI 60 Query: 253 YWIPDGYRPVLVRTEDLPLLVGTEYNASPTEYNNLPSPSNSS 378 +WIPDGYRPVLVRT DLPLLVG EY NLPSPSNS+ Sbjct: 61 FWIPDGYRPVLVRTSDLPLLVGAEY--------NLPSPSNST 94