BLASTX nr result
ID: Ophiopogon27_contig00046127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00046127 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020583787.1| ethylene-responsive transcription factor ABR... 64 6e-09 ref|XP_008785849.1| PREDICTED: ethylene-responsive transcription... 64 8e-09 ref|XP_020693394.1| ethylene-responsive transcription factor ERF... 63 1e-08 ref|XP_008784254.1| PREDICTED: ethylene-responsive transcription... 62 2e-08 ref|XP_009420584.1| PREDICTED: ethylene-responsive transcription... 60 8e-08 ref|XP_008781454.1| PREDICTED: ethylene-responsive transcription... 60 1e-07 ref|XP_010930947.1| PREDICTED: ethylene-responsive transcription... 60 1e-07 ref|XP_010927404.1| PREDICTED: AP2-like ethylene-responsive tran... 60 1e-07 ref|XP_020107227.1| ethylene-responsive transcription factor ERF... 58 5e-07 gb|OAY74045.1| Ethylene-responsive transcription factor ERF112 [... 58 6e-07 ref|XP_010912020.1| PREDICTED: ethylene-responsive transcription... 58 9e-07 ref|XP_009408302.2| PREDICTED: ethylene-responsive transcription... 57 2e-06 >ref|XP_020583787.1| ethylene-responsive transcription factor ABR1-like [Phalaenopsis equestris] Length = 372 Score = 63.9 bits (154), Expect = 6e-09 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -1 Query: 462 EPQPLAGFIQTPGISRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATST 316 EP + QT G++RDY+EYSRLLQG GEYQ +PPT+LLDQ+M+++S+ Sbjct: 253 EPVWPSSLSQTMGMARDYVEYSRLLQGTGEYQGMPPTALLDQLMHSSSS 301 >ref|XP_008785849.1| PREDICTED: ethylene-responsive transcription factor ERF110-like [Phoenix dactylifera] Length = 360 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATSTGSM 307 SRDYLEYSRLLQG G+YQR+PPTSLLDQ MY+ + +M Sbjct: 245 SRDYLEYSRLLQGVGDYQRLPPTSLLDQFMYSNYSSAM 282 >ref|XP_020693394.1| ethylene-responsive transcription factor ERF110-like [Dendrobium catenatum] gb|PKU70564.1| Ethylene-responsive transcription factor ERF114 [Dendrobium catenatum] Length = 388 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 435 QTPGISRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATST 316 QT ++RDY+EYSRLLQG GEYQ +PPT+LLDQ+MY++S+ Sbjct: 275 QTMDVTRDYVEYSRLLQGTGEYQGMPPTALLDQLMYSSSS 314 >ref|XP_008784254.1| PREDICTED: ethylene-responsive transcription factor ERF110-like [Phoenix dactylifera] Length = 379 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = -1 Query: 462 EPQPLAGF--IQTPGISRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATST 316 E QP +G +Q S DYLEYSRLLQG GEYQRIPPT+L Q+MY+ S+ Sbjct: 251 ESQPFSGLSGLQASSASSDYLEYSRLLQGTGEYQRIPPTALWHQMMYSGSS 301 >ref|XP_009420584.1| PREDICTED: ethylene-responsive transcription factor ERF110-like [Musa acuminata subsp. malaccensis] Length = 309 Score = 60.5 bits (145), Expect = 8e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATSTGSMP 304 +RDY+EYSRLL+G GEYQR+PPT+LLDQ+MY+ ++ + P Sbjct: 218 ARDYMEYSRLLRGEGEYQRMPPTALLDQMMYSGASAASP 256 >ref|XP_008781454.1| PREDICTED: ethylene-responsive transcription factor ABR1-like [Phoenix dactylifera] Length = 391 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -1 Query: 462 EPQPLAGFIQTPGISRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATST 316 E QP A +Q SRDYLEYS LLQG G+Y+ +PPT+LL+Q+MY++S+ Sbjct: 261 ESQPFA-LLQASSASRDYLEYSSLLQGTGQYRTLPPTALLEQMMYSSSS 308 >ref|XP_010930947.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Elaeis guineensis] Length = 392 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 462 EPQPLAGFIQTPGISRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATST 316 E QP A +Q G SRDY+EYSRLLQG GEY+ PT+LL+Q+MY++S+ Sbjct: 260 ESQPFAR-LQASGASRDYVEYSRLLQGTGEYRTFSPTALLEQMMYSSSS 307 >ref|XP_010927404.1| PREDICTED: AP2-like ethylene-responsive transcription factor PLT2 [Elaeis guineensis] Length = 361 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATSTGSMP 304 SRDYLEYSRLLQG G+YQR+PPTSLLD+ MY ++P Sbjct: 258 SRDYLEYSRLLQGDGKYQRLPPTSLLDRFMYPNHPWAVP 296 >ref|XP_020107227.1| ethylene-responsive transcription factor ERF110-like, partial [Ananas comosus] Length = 294 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATS 319 S DYLEYSRLLQGAGEYQR+ PT+LLDQ++Y+ S Sbjct: 168 SGDYLEYSRLLQGAGEYQRLSPTALLDQVIYSQS 201 >gb|OAY74045.1| Ethylene-responsive transcription factor ERF112 [Ananas comosus] Length = 339 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATS 319 S DYLEYSRLLQGAGEYQR+ PT+LLDQ++Y+ S Sbjct: 213 SGDYLEYSRLLQGAGEYQRLSPTALLDQVIYSQS 246 >ref|XP_010912020.1| PREDICTED: ethylene-responsive transcription factor ABR1-like [Elaeis guineensis] Length = 434 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 420 SRDYLEYSRLLQGAGEYQRIPPTSLLDQIMYATSTGSM 307 SRDY+EYSRLLQG G YQR+PPTSLLDQ M + + +M Sbjct: 320 SRDYIEYSRLLQGVGPYQRLPPTSLLDQYMSSNYSSAM 357 >ref|XP_009408302.2| PREDICTED: ethylene-responsive transcription factor ERF037-like [Musa acuminata subsp. malaccensis] Length = 360 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 414 DYLEYSRLLQGAGEYQRIPPTSLLDQIMYATSTGSM 307 DYLEYSRLLQGAGEYQR+P TSL D +MY++ +M Sbjct: 256 DYLEYSRLLQGAGEYQRLPATSLFDSVMYSSYAPTM 291