BLASTX nr result
ID: Ophiopogon27_contig00045903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045903 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG72083.1| hypothetical protein GLOIN_2v1600241 [Rhizophagus... 72 2e-14 >gb|POG72083.1| hypothetical protein GLOIN_2v1600241 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 65 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 168 WLACFTILCISNSTLTINEIMNLFARIIFYAELPLLPFTL 49 ++ FTILCISNSTLTINEIMNLF R+IFYAELPLLPFTL Sbjct: 26 FVGLFTILCISNSTLTINEIMNLFVRVIFYAELPLLPFTL 65