BLASTX nr result
ID: Ophiopogon27_contig00045851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045851 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC43863.1| hypothetical protein RIR_2677600 [Rhizophagus ir... 89 6e-20 >dbj|GBC43863.1| hypothetical protein RIR_2677600 [Rhizophagus irregularis DAOM 181602] Length = 85 Score = 89.0 bits (219), Expect = 6e-20 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -1 Query: 301 KDHSNRITRCGDINDQS*KLKINLLNVFIRHLVIRFL*FWVHWIDLDFLFRMNINSFV 128 KDHS+ I CGDINDQ K KIN+L+VFIR LVI L FW+HWIDLDFLFRM+INSFV Sbjct: 28 KDHSDWIITCGDINDQIQKWKINVLDVFIRQLVICTLRFWIHWIDLDFLFRMDINSFV 85