BLASTX nr result
ID: Ophiopogon27_contig00045831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045831 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhi... 56 8e-07 >gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhizophagus irregularis] Length = 202 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +2 Query: 38 AEWSYIGYLETMQLYFDDS-KLKSLKSVWKRRFNEQLKEI 154 +EW+Y GYLE MQ YF++ KL SLKS WK+RFNE L+EI Sbjct: 21 SEWTYPGYLEKMQPYFNNHFKLSSLKSTWKKRFNEHLREI 60