BLASTX nr result
ID: Ophiopogon27_contig00045830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045830 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhi... 42 1e-07 >gb|PKK56495.1| hypothetical protein RhiirC2_872019, partial [Rhizophagus irregularis] Length = 202 Score = 42.4 bits (98), Expect(3) = 1e-07 Identities = 27/67 (40%), Positives = 36/67 (53%), Gaps = 21/67 (31%) Frame = -1 Query: 290 STNVNIQLSTLKVMSNAATHQENEL---------------------KRQSDNYLERGNQN 174 +TN++IQLSTL+VMS +AT QE+EL KRQSD Y ER Q Sbjct: 102 NTNIDIQLSTLRVMSTSATCQEDELAGQMVASSISGKKNVKHNKNAKRQSDEYPEREKQK 161 Query: 173 HVKLALK 153 K +++ Sbjct: 162 SRKTSIE 168 Score = 35.0 bits (79), Expect(3) = 1e-07 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 118 KLNNALVAQEDFDENGEEEVIQ 53 +LNN L QE FDEN EEEVIQ Sbjct: 178 RLNNVLNVQESFDENDEEEVIQ 199 Score = 25.0 bits (53), Expect(3) = 1e-07 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 165 TSIENSHQAESS 130 TSIENSHQAE S Sbjct: 165 TSIENSHQAECS 176