BLASTX nr result
ID: Ophiopogon27_contig00045780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045780 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY43338.1| WD40 repeat-like protein [Rhizophagus irregularis] 64 2e-09 gb|EXX56571.1| dynein intermediate chain [Rhizophagus irregulari... 64 2e-09 >gb|PKY43338.1| WD40 repeat-like protein [Rhizophagus irregularis] Length = 634 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 267 RFIPNFATFEAVILDIPPKEIVFYNKEVQTKD 362 RFIPNF TFEAVILDIPPKEIV YNKEVQTKD Sbjct: 111 RFIPNFITFEAVILDIPPKEIVHYNKEVQTKD 142 >gb|EXX56571.1| dynein intermediate chain [Rhizophagus irregularis DAOM 197198w] dbj|GBC38438.1| Dynein intermediate chain [Rhizophagus irregularis DAOM 181602] gb|PKC09517.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|PKC65446.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|PKK69342.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|PKY21679.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|POG60388.1| dynein intermediate chain [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 634 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 267 RFIPNFATFEAVILDIPPKEIVFYNKEVQTKD 362 RFIPNF TFEAVILDIPPKEIV YNKEVQTKD Sbjct: 111 RFIPNFITFEAVILDIPPKEIVHYNKEVQTKD 142