BLASTX nr result
ID: Ophiopogon27_contig00045395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045395 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK58150.1| hypothetical protein RhiirC2_763572 [Rhizophagus ... 47 3e-08 gb|EXX70526.1| hypothetical protein RirG_086540 [Rhizophagus irr... 47 8e-08 dbj|GBC12532.1| hypothetical protein RIR_0140700 [Rhizophagus ir... 50 2e-07 gb|PKC73331.1| hypothetical protein RhiirA1_410693 [Rhizophagus ... 47 6e-07 >gb|PKK58150.1| hypothetical protein RhiirC2_763572 [Rhizophagus irregularis] Length = 149 Score = 47.4 bits (111), Expect(3) = 3e-08 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 11/82 (13%) Frame = -3 Query: 477 KIGK*ERFLSDYR---AYFNIIVQGKTEASIWSIVQFVIY---GGGKVDYSYY*KESISR 316 KI + + LSDYR YFN+ ++ K E IWS V+F +Y K + + KE IS+ Sbjct: 6 KILENKNALSDYRDWITYFNLALETKLEPKIWSTVKFAVYRKVTDEKENCAEREKEPISQ 65 Query: 315 L-----GVNMSFYD*ELLILIR 265 L GVNMS Y+ ELLI ++ Sbjct: 66 LENVLKGVNMSIYEYELLIWMK 87 Score = 35.8 bits (81), Expect(3) = 3e-08 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = -1 Query: 236 KH*TLEQAEIKLQTSFPEEMNLFKKPLQKV 147 K T +QAE++L+ SFP++M + K+PLQKV Sbjct: 98 KRQTRKQAELQLKESFPKDMMVLKEPLQKV 127 Score = 21.9 bits (45), Expect(3) = 3e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 494 MDKLLKKLENKNA 456 M +LLK LENKNA Sbjct: 1 MGELLKILENKNA 13 >gb|EXX70526.1| hypothetical protein RirG_086540 [Rhizophagus irregularis DAOM 197198w] dbj|GBC53830.1| hypothetical protein RIR_3494100 [Rhizophagus irregularis DAOM 181602] gb|PKC14331.1| hypothetical protein RhiirA5_350500 [Rhizophagus irregularis] gb|PKY23630.1| hypothetical protein RhiirB3_412079 [Rhizophagus irregularis] gb|POG75081.1| hypothetical protein GLOIN_2v1570585 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 149 Score = 47.4 bits (111), Expect(3) = 8e-08 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 11/82 (13%) Frame = -3 Query: 477 KIGK*ERFLSDYR---AYFNIIVQGKTEASIWSIVQFVIY---GGGKVDYSYY*KESISR 316 KI + + LSDYR YFN+ ++ K E IWS V+F +Y K + + KE IS+ Sbjct: 6 KILENKNALSDYRDWITYFNLALETKLEPKIWSTVKFAVYRKVTDEKENCAEREKEPISQ 65 Query: 315 L-----GVNMSFYD*ELLILIR 265 L GVNMS Y+ ELLI ++ Sbjct: 66 LENVLKGVNMSIYEYELLIWMK 87 Score = 34.3 bits (77), Expect(3) = 8e-08 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = -1 Query: 236 KH*TLEQAEIKLQTSFPEEMNLFKKPLQK 150 K T +QAE++L+ SFP++M + K+PLQK Sbjct: 98 KRQTRKQAELQLKESFPKDMMVLKEPLQK 126 Score = 21.9 bits (45), Expect(3) = 8e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 494 MDKLLKKLENKNA 456 M +LLK LENKNA Sbjct: 1 MGELLKILENKNA 13 >dbj|GBC12532.1| hypothetical protein RIR_0140700 [Rhizophagus irregularis DAOM 181602] Length = 92 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -3 Query: 219 TGRNKTSNIISRRNEPLQETFAKGFQRS 136 TG NKTS+ ISRRNEPLQ TFAKGFQRS Sbjct: 8 TGGNKTSDFISRRNEPLQGTFAKGFQRS 35 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 53 N*FFICITTDLAQRRPF 3 N F CITTDLAQRRPF Sbjct: 45 NFIFACITTDLAQRRPF 61 >gb|PKC73331.1| hypothetical protein RhiirA1_410693 [Rhizophagus irregularis] Length = 149 Score = 47.0 bits (110), Expect(2) = 6e-07 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 11/74 (14%) Frame = -3 Query: 453 LSDYR---AYFNIIVQGKTEASIWSIVQFVIY---GGGKVDYSYY*KESISRL-----GV 307 LSDYR YFN+ ++ K E IWS V+F +Y K + + KE IS+L GV Sbjct: 14 LSDYRDWITYFNLALETKLEPKIWSTVKFAVYRKVTDEKENCAEREKEPISQLENVLKGV 73 Query: 306 NMSFYD*ELLILIR 265 NMS Y+ ELLI ++ Sbjct: 74 NMSIYEYELLIWMK 87 Score = 34.3 bits (77), Expect(2) = 6e-07 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = -1 Query: 236 KH*TLEQAEIKLQTSFPEEMNLFKKPLQK 150 K T +QAE++L+ SFP++M + K+PLQK Sbjct: 98 KRQTRKQAELQLKESFPKDMMVLKEPLQK 126