BLASTX nr result
ID: Ophiopogon27_contig00045387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045387 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX51810.1| hypothetical protein RirG_258430 [Rhizophagus irr... 92 4e-22 gb|PKC69578.1| hypothetical protein RhiirA1_415464 [Rhizophagus ... 83 2e-18 >gb|EXX51810.1| hypothetical protein RirG_258430 [Rhizophagus irregularis DAOM 197198w] gb|EXX51811.1| hypothetical protein RirG_258430 [Rhizophagus irregularis DAOM 197198w] gb|EXX51812.1| hypothetical protein RirG_258430 [Rhizophagus irregularis DAOM 197198w] dbj|GBC24174.1| JEMT01029574.1_cds_EXX51812.1_28217 [Rhizophagus irregularis DAOM 181602] gb|PKC02533.1| hypothetical protein RhiirA5_364065 [Rhizophagus irregularis] Length = 91 Score = 92.4 bits (228), Expect = 4e-22 Identities = 48/64 (75%), Positives = 51/64 (79%) Frame = +3 Query: 3 AIQQRPLLEKPATHALSTVFFGGVGSYVYYLEKRQLELIQTRKKTLLXXXXXXXXXXXAK 182 AIQQRPLL+KPATHALSTVFFGGVGSYVYYLEKRQLELIQ RK+TLL AK Sbjct: 24 AIQQRPLLDKPATHALSTVFFGGVGSYVYYLEKRQLELIQKRKQTLLENRRRRREYEEAK 83 Query: 183 ADEN 194 A E+ Sbjct: 84 AREH 87 >gb|PKC69578.1| hypothetical protein RhiirA1_415464 [Rhizophagus irregularis] gb|PKK74821.1| hypothetical protein RhiirC2_738020 [Rhizophagus irregularis] gb|PKY20315.1| hypothetical protein RhiirB3_408098 [Rhizophagus irregularis] gb|PKY40531.1| hypothetical protein RhiirA4_394798 [Rhizophagus irregularis] gb|POG82561.1| hypothetical protein GLOIN_2v1496162 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 87 Score = 82.8 bits (203), Expect = 2e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +3 Query: 3 AIQQRPLLEKPATHALSTVFFGGVGSYVYYLEKRQLELIQTR 128 AIQQRPLL+KPATHALSTVFFGGVGSYVYYLEKRQLELIQ R Sbjct: 24 AIQQRPLLDKPATHALSTVFFGGVGSYVYYLEKRQLELIQKR 65