BLASTX nr result
ID: Ophiopogon27_contig00045177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00045177 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK68882.1| hypothetical protein RhiirC2_781697 [Rhizophagus ... 84 8e-19 gb|PKC04331.1| hypothetical protein RhiirA5_422396 [Rhizophagus ... 81 6e-18 >gb|PKK68882.1| hypothetical protein RhiirC2_781697 [Rhizophagus irregularis] Length = 49 Score = 83.6 bits (205), Expect = 8e-19 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 23 MKFNIFLLLLTIFVAFVAVTLAAPLEPASKSDVTPAVNPDGC 148 MKFNIFLLLLTIFVAFVAVTLAAPLEPASKSDVTPAV+PDGC Sbjct: 1 MKFNIFLLLLTIFVAFVAVTLAAPLEPASKSDVTPAVHPDGC 42 >gb|PKC04331.1| hypothetical protein RhiirA5_422396 [Rhizophagus irregularis] gb|PKC66348.1| hypothetical protein RhiirA1_459858 [Rhizophagus irregularis] gb|PKY26402.1| hypothetical protein RhiirB3_441699 [Rhizophagus irregularis] Length = 49 Score = 81.3 bits (199), Expect = 6e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 23 MKFNIFLLLLTIFVAFVAVTLAAPLEPASKSDVTPAVNPDGC 148 MKFNIFLLL TIFVAFVAVTLAAPLEPASKSDVTPAV+PDGC Sbjct: 1 MKFNIFLLLSTIFVAFVAVTLAAPLEPASKSDVTPAVHPDGC 42