BLASTX nr result
ID: Ophiopogon27_contig00044600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044600 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC46560.1| hypothetical protein RIR_2893600 [Rhizophagus ir... 67 1e-11 >dbj|GBC46560.1| hypothetical protein RIR_2893600 [Rhizophagus irregularis DAOM 181602] Length = 95 Score = 67.0 bits (162), Expect = 1e-11 Identities = 36/70 (51%), Positives = 45/70 (64%) Frame = +2 Query: 149 STPLADLNKEKTIMFSTTSEGSKIVCGSHYQDQRVKFDVLPTNDKKERKPPQRRRTPYAW 328 ST AD E + T + +K +CG Q VKF LPT +KKE+K +RRRTPYAW Sbjct: 19 STTFAD---EPKPIKDTLIDPTKELCGDKEDQQHVKFGTLPTIEKKEKKV-KRRRTPYAW 74 Query: 329 DDQLRPIFDD 358 DD+LRP+FDD Sbjct: 75 DDKLRPVFDD 84