BLASTX nr result
ID: Ophiopogon27_contig00044411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044411 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK71063.1| hypothetical protein RhiirC2_865826 [Rhizophagus ... 52 1e-06 gb|PKY63262.1| hypothetical protein RhiirA4_551449 [Rhizophagus ... 54 3e-06 gb|PKB92442.1| hypothetical protein RhiirA5_508277 [Rhizophagus ... 52 8e-06 gb|PKY32820.1| hypothetical protein RhiirB3_420297 [Rhizophagus ... 52 9e-06 >gb|PKK71063.1| hypothetical protein RhiirC2_865826 [Rhizophagus irregularis] Length = 345 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 326 RSQTVSTLEVAIQSKLGAPFNQVRLDIYQVPDETLM 219 +SQTV+ LE AIQSKLG PFN VRL I+Q DE LM Sbjct: 229 KSQTVNALETAIQSKLGTPFNNVRLAIHQTSDEALM 264 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -2 Query: 217 MQPQALFSSVFNEEPRADCYHVVVR 143 MQPQAL SS FN YH+VVR Sbjct: 264 MQPQALISSFFN-------YHIVVR 281 >gb|PKY63262.1| hypothetical protein RhiirA4_551449 [Rhizophagus irregularis] Length = 102 Score = 53.9 bits (128), Expect = 3e-06 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 9/94 (9%) Frame = -2 Query: 397 ESKMILTCLIIPCGQLHGL---------TIDNAGVKQLAHLKLQFKANWGHPLIKFA*TS 245 E +IL CLI+PCGQLH L T+D + + +Q + I+ Sbjct: 5 EDNIILHCLIVPCGQLHALPRDRVWQTVTVDRSQAVSVLEATIQNRLGVPFNTIRLKIRQ 64 Query: 244 IKFPMRRLCMQPQALFSSVFNEEPRADCYHVVVR 143 + FP MQPQ L S+ F+E+PR D YHVV + Sbjct: 65 V-FPSEAP-MQPQDLISTFFDEQPRPDYYHVVAQ 96 >gb|PKB92442.1| hypothetical protein RhiirA5_508277 [Rhizophagus irregularis] Length = 65 Score = 51.6 bits (122), Expect = 8e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 326 RSQTVSTLEVAIQSKLGAPFNQVRLDIYQVPDETLM 219 R+ TVS LEVAIQS L PFN VRL +Y+ PDETLM Sbjct: 30 RNPTVSVLEVAIQSTLRTPFNSVRLKLYRTPDETLM 65 >gb|PKY32820.1| hypothetical protein RhiirB3_420297 [Rhizophagus irregularis] Length = 71 Score = 51.6 bits (122), Expect = 9e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 326 RSQTVSTLEVAIQSKLGAPFNQVRLDIYQVPDETLM 219 R+ TVS LEVAIQS L PFN VRL +Y+ PDETLM Sbjct: 36 RNPTVSVLEVAIQSTLRTPFNSVRLKLYRTPDETLM 71