BLASTX nr result
ID: Ophiopogon27_contig00044366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044366 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX60649.1| hypothetical protein RirG_178000 [Rhizophagus irr... 125 1e-33 gb|POG73933.1| hypothetical protein GLOIN_2v1580859, partial [Rh... 98 7e-23 >gb|EXX60649.1| hypothetical protein RirG_178000 [Rhizophagus irregularis DAOM 197198w] gb|PKC09942.1| hypothetical protein RhiirA5_356088 [Rhizophagus irregularis] gb|PKC72642.1| hypothetical protein RhiirA1_411579 [Rhizophagus irregularis] gb|PKK71090.1| hypothetical protein RhiirC2_745230 [Rhizophagus irregularis] gb|PKY13089.1| hypothetical protein RhiirB3_398367 [Rhizophagus irregularis] gb|PKY38028.1| hypothetical protein RhiirA4_391359 [Rhizophagus irregularis] Length = 166 Score = 125 bits (315), Expect = 1e-33 Identities = 62/67 (92%), Positives = 63/67 (94%), Gaps = 2/67 (2%) Frame = -2 Query: 479 ADGSVDD-YDDEHEHSEKIEQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKD-DVQPPKG 306 ADGSVDD YDDEH SEK+EQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKD DVQPPKG Sbjct: 102 ADGSVDDGYDDEH--SEKVEQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKDGDVQPPKG 159 Query: 305 CCACTIM 285 CCACTIM Sbjct: 160 CCACTIM 166 >gb|POG73933.1| hypothetical protein GLOIN_2v1580859, partial [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 152 Score = 97.8 bits (242), Expect = 7e-23 Identities = 48/52 (92%), Positives = 49/52 (94%), Gaps = 1/52 (1%) Frame = -2 Query: 479 ADGSVDD-YDDEHEHSEKIEQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKD 327 ADGSVDD YDDEH SEK+EQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKD Sbjct: 102 ADGSVDDGYDDEH--SEKVEQPPQPSEKDRKKGKKFLCFNFGGKSNPLSEKD 151