BLASTX nr result
ID: Ophiopogon27_contig00044310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044310 (706 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG64669.1| hypothetical protein GLOIN_2v1806234 [Rhizophagus... 76 3e-12 gb|PKC55502.1| hypothetical protein RhiirA1_475492 [Rhizophagus ... 67 3e-09 gb|PKY34440.1| hypothetical protein RhiirB3_454146 [Rhizophagus ... 66 7e-09 gb|PKB97651.1| hypothetical protein RhiirA5_432721 [Rhizophagus ... 66 7e-09 >gb|POG64669.1| hypothetical protein GLOIN_2v1806234 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 554 Score = 76.3 bits (186), Expect = 3e-12 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +1 Query: 388 TVVIKIIWNDECGKMAILDCFLCIFYVFCLFLFPKNYAHHCSSR 519 TVVIKIIWNDEC KM IL +L +FYV CLFLFPK YAHHC+ R Sbjct: 335 TVVIKIIWNDECVKMTILGSYLYVFYVICLFLFPKKYAHHCTLR 378 >gb|PKC55502.1| hypothetical protein RhiirA1_475492 [Rhizophagus irregularis] Length = 592 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 388 TVVIKIIWNDECGKMAIL-DCFLCIFYVFCLFLFPKNYAHHC 510 TVVIKIIWNDE KMAIL +L +FYVFCLFLFPK YA+HC Sbjct: 247 TVVIKIIWNDEYVKMAILLGSYLYVFYVFCLFLFPKKYAYHC 288 >gb|PKY34440.1| hypothetical protein RhiirB3_454146 [Rhizophagus irregularis] Length = 600 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 388 TVVIKIIWNDECGKMAIL-DCFLCIFYVFCLFLFPKNYAHHC 510 TVVIKIIWNDE KMAIL +L +FYVFCLFLFPK YA+HC Sbjct: 264 TVVIKIIWNDEYVKMAILLGSYLYVFYVFCLFLFPKIYAYHC 305 >gb|PKB97651.1| hypothetical protein RhiirA5_432721 [Rhizophagus irregularis] Length = 609 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 388 TVVIKIIWNDECGKMAIL-DCFLCIFYVFCLFLFPKNYAHHC 510 TVVIKIIWNDE KMAIL +L +FYVFCLFLFPK YA+HC Sbjct: 264 TVVIKIIWNDEYVKMAILLGSYLYVFYVFCLFLFPKIYAYHC 305