BLASTX nr result
ID: Ophiopogon27_contig00044165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044165 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO28886.1| hypothetical protein M407DRAFT_175589 [Tulasnella... 85 8e-17 >gb|KIO28886.1| hypothetical protein M407DRAFT_175589 [Tulasnella calospora MUT 4182] Length = 298 Score = 84.7 bits (208), Expect = 8e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 48 VKATSTTITFPAAAAGHARSISFRGPSGWFGHGRFGHGC 164 VKATSTTITFPAAAAGH RSISFRGP+GWFGHGRFGHGC Sbjct: 229 VKATSTTITFPAAAAGHPRSISFRGPTGWFGHGRFGHGC 267