BLASTX nr result
ID: Ophiopogon27_contig00044137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00044137 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK78801.1| hypothetical protein RhiirC2_728766 [Rhizophagus ... 62 3e-10 gb|POG65916.1| hypothetical protein GLOIN_2v1844471 [Rhizophagus... 58 6e-07 >gb|PKK78801.1| hypothetical protein RhiirC2_728766 [Rhizophagus irregularis] Length = 61 Score = 62.4 bits (150), Expect = 3e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 YAGYTKTKTKSDYLSSIRTQSAIVLGSNWFASSKN 107 YAGY KTK KSDYLSS+ TQ+A+ LGSNWFASSKN Sbjct: 24 YAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSKN 58 >gb|POG65916.1| hypothetical protein GLOIN_2v1844471 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 524 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 YAGYTKTKTKSDYLSSIRTQSAIVLGSNWFASS 101 YAGY KTK KSDYLSS+ TQ+A+ LGSNWFASS Sbjct: 24 YAGYKKTKNKSDYLSSLGTQNAVALGSNWFASS 56