BLASTX nr result
ID: Ophiopogon27_contig00043915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00043915 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX67332.1| hypothetical protein RirG_115380 [Rhizophagus irr... 59 1e-08 gb|PKC60477.1| hypothetical protein RhiirA1_467964 [Rhizophagus ... 56 1e-07 dbj|GBC49405.1| hypothetical protein RIR_3131000 [Rhizophagus ir... 56 2e-07 gb|PKC00817.1| hypothetical protein RhiirA5_427660 [Rhizophagus ... 54 5e-07 >gb|EXX67332.1| hypothetical protein RirG_115380 [Rhizophagus irregularis DAOM 197198w] dbj|GBC49406.1| hypothetical protein RIR_3131000 [Rhizophagus irregularis DAOM 181602] gb|PKY52940.1| hypothetical protein RhiirA4_408724 [Rhizophagus irregularis] Length = 68 Score = 58.5 bits (140), Expect = 1e-08 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 4/70 (5%) Frame = +1 Query: 169 LLYILFTIIVSSL----PVHSYPAGSCDIENCEDEIAEFRFEETDPWTQNEFSEQSMFEE 336 L YIL I++ SL V+SYP GSCDIENCEDE+AE R DPW+ E + Sbjct: 5 LFYILSIIVILSLLHTSSVYSYPVGSCDIENCEDEMAE-REYNPDPWSDEELTVLD---- 59 Query: 337 LLPGIFDSML 366 LP IF+ ML Sbjct: 60 -LPEIFNIML 68 >gb|PKC60477.1| hypothetical protein RhiirA1_467964 [Rhizophagus irregularis] gb|PKK59465.1| hypothetical protein RhiirC2_762645 [Rhizophagus irregularis] gb|PKY20355.1| hypothetical protein RhiirB3_524241 [Rhizophagus irregularis] Length = 61 Score = 55.8 bits (133), Expect = 1e-07 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +1 Query: 169 LLYILFTIIVSSL----PVHSYPAGSCDIENCEDEIAEFRFEETDPWTQNEFS 315 L YIL I++ SL V+SYP GSCDIENCEDE+AE R DPW+ E + Sbjct: 5 LFYILSIIVILSLLHTSSVYSYPVGSCDIENCEDEMAE-REYNPDPWSDEELT 56 >dbj|GBC49405.1| hypothetical protein RIR_3131000 [Rhizophagus irregularis DAOM 181602] gb|POG61041.1| hypothetical protein GLOIN_2v1707620 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 78 Score = 55.8 bits (133), Expect = 2e-07 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +1 Query: 169 LLYILFTIIVSSL----PVHSYPAGSCDIENCEDEIAEFRFEETDPWTQNEFS 315 L YIL I++ SL V+SYP GSCDIENCEDE+AE R DPW+ E + Sbjct: 5 LFYILSIIVILSLLHTSSVYSYPVGSCDIENCEDEMAE-REYNPDPWSDEELT 56 >gb|PKC00817.1| hypothetical protein RhiirA5_427660 [Rhizophagus irregularis] Length = 61 Score = 54.3 bits (129), Expect = 5e-07 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 4/53 (7%) Frame = +1 Query: 169 LLYILFTIIVSSL----PVHSYPAGSCDIENCEDEIAEFRFEETDPWTQNEFS 315 L YIL I+ SL V+SYP GSCDIENCEDE+AE R DPW+ E + Sbjct: 5 LFYILSIIVFLSLLHTSSVYSYPVGSCDIENCEDEMAE-REYNPDPWSDEELT 56