BLASTX nr result
ID: Ophiopogon27_contig00043894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00043894 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX69866.1| Vps21p [Rhizophagus irregularis DAOM 197198w] >gi... 71 7e-12 >gb|EXX69866.1| Vps21p [Rhizophagus irregularis DAOM 197198w] gb|EXX79962.1| Vps21p [Rhizophagus irregularis DAOM 197198w] dbj|GBC35023.1| Ras-related protein Rab-5C [Rhizophagus irregularis DAOM 181602] gb|PKC17351.1| ras-domain-containing protein [Rhizophagus irregularis] gb|PKC71201.1| ras-domain-containing protein [Rhizophagus irregularis] gb|PKY13680.1| ras-domain-containing protein [Rhizophagus irregularis] gb|PKY38353.1| ras-domain-containing protein [Rhizophagus irregularis] Length = 247 Score = 71.2 bits (173), Expect = 7e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 KKGDGVRDVFTEIAKKIPLELMMSPRPRNQIVNGGPS 113 KKGDGVRDVFTEIAKKIPLELMMSPRPR QIVNGGPS Sbjct: 190 KKGDGVRDVFTEIAKKIPLELMMSPRPR-QIVNGGPS 225