BLASTX nr result
ID: Ophiopogon27_contig00043336
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00043336 (750 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC05701.1| hypothetical protein RhiirA5_420587 [Rhizophagus ... 79 7e-16 gb|PKY48776.1| hypothetical protein RhiirA4_464465 [Rhizophagus ... 73 3e-14 gb|PKK59637.1| hypothetical protein RhiirC2_794550 [Rhizophagus ... 73 3e-14 gb|PKC67105.1| hypothetical protein RhiirA1_458838 [Rhizophagus ... 73 3e-14 gb|EXX77855.1| hypothetical protein RirG_020030 [Rhizophagus irr... 73 3e-14 >gb|PKC05701.1| hypothetical protein RhiirA5_420587 [Rhizophagus irregularis] gb|PKY16582.1| hypothetical protein RhiirB3_429033 [Rhizophagus irregularis] Length = 474 Score = 78.6 bits (192), Expect(2) = 7e-16 Identities = 47/70 (67%), Positives = 49/70 (70%), Gaps = 7/70 (10%) Frame = -1 Query: 750 KLSINDEVGSKYKERILEYEIYKLIFNRCINC-----*CKVFLLVYQEEIFFY--LRSLE 592 KL INDEVGSKYKERILE+EIYKLIFNRC N K L Y FF+ LRSLE Sbjct: 115 KLLINDEVGSKYKERILEFEIYKLIFNRCNNAKNFHWYTKKRLYRYPNAKFFFSKLRSLE 174 Query: 591 IYSRGITSKT 562 IY RGITSKT Sbjct: 175 IYPRGITSKT 184 Score = 33.9 bits (76), Expect(2) = 7e-16 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 556 NLTNLEICMCDKDTPG 509 NLTNLEI MCD+DTPG Sbjct: 194 NLTNLEIHMCDEDTPG 209 >gb|PKY48776.1| hypothetical protein RhiirA4_464465 [Rhizophagus irregularis] Length = 474 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 9/72 (12%) Frame = -1 Query: 750 KLSINDEVGSKYKERILEYEIYKLIFNRCINC*CKVFLLVYQEEIFFY---------LRS 598 KL INDEVGSKYKERILE+EIYKLIFNRC N K F ++ ++ Y LRS Sbjct: 115 KLLINDEVGSKYKERILEFEIYKLIFNRCNN--AKNFHWYTKKRLYRYPNAKNFFSKLRS 172 Query: 597 LEIYSRGITSKT 562 LEI RGITSKT Sbjct: 173 LEISPRGITSKT 184 Score = 33.9 bits (76), Expect(2) = 3e-14 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 556 NLTNLEICMCDKDTPG 509 NLTNLEI MCD+DTPG Sbjct: 194 NLTNLEIHMCDEDTPG 209 >gb|PKK59637.1| hypothetical protein RhiirC2_794550 [Rhizophagus irregularis] Length = 474 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 9/72 (12%) Frame = -1 Query: 750 KLSINDEVGSKYKERILEYEIYKLIFNRCINC*CKVFLLVYQEEIFFY---------LRS 598 KL INDEVGSKYKERILE+EIYKLIFNRC N K F ++ ++ Y LRS Sbjct: 115 KLLINDEVGSKYKERILEFEIYKLIFNRCNN--AKNFHWYTKKRLYRYPNAKKFFSKLRS 172 Query: 597 LEIYSRGITSKT 562 LEI RGITSKT Sbjct: 173 LEISPRGITSKT 184 Score = 33.9 bits (76), Expect(2) = 3e-14 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 556 NLTNLEICMCDKDTPG 509 NLTNLEI MCD+DTPG Sbjct: 194 NLTNLEIHMCDEDTPG 209 >gb|PKC67105.1| hypothetical protein RhiirA1_458838 [Rhizophagus irregularis] Length = 474 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 9/72 (12%) Frame = -1 Query: 750 KLSINDEVGSKYKERILEYEIYKLIFNRCINC*CKVFLLVYQEEIFFY---------LRS 598 KL INDEVGSKYKERILE+EIYKLIFNRC N K F ++ ++ Y LRS Sbjct: 115 KLLINDEVGSKYKERILEFEIYKLIFNRCNN--AKNFHWYTKKRLYRYPNAKNFFSKLRS 172 Query: 597 LEIYSRGITSKT 562 LEI RGITSKT Sbjct: 173 LEISPRGITSKT 184 Score = 33.9 bits (76), Expect(2) = 3e-14 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 556 NLTNLEICMCDKDTPG 509 NLTNLEI MCD+DTPG Sbjct: 194 NLTNLEIHMCDEDTPG 209 >gb|EXX77855.1| hypothetical protein RirG_020030 [Rhizophagus irregularis DAOM 197198w] dbj|GBC50671.1| hypothetical protein RIR_3230900 [Rhizophagus irregularis DAOM 181602] gb|POG75236.1| hypothetical protein GLOIN_2v1770441 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 474 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 9/72 (12%) Frame = -1 Query: 750 KLSINDEVGSKYKERILEYEIYKLIFNRCINC*CKVFLLVYQEEIFFY---------LRS 598 KL INDEVGSKYKERILE+EIYKLIFNRC N K F ++ ++ Y LRS Sbjct: 115 KLLINDEVGSKYKERILEFEIYKLIFNRCNN--AKNFHWYTKKRLYRYPNAKIFFSKLRS 172 Query: 597 LEIYSRGITSKT 562 LEI RGITSKT Sbjct: 173 LEISPRGITSKT 184 Score = 33.9 bits (76), Expect(2) = 3e-14 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 556 NLTNLEICMCDKDTPG 509 NLTNLEI MCD+DTPG Sbjct: 194 NLTNLEIHMCDEDTPG 209