BLASTX nr result
ID: Ophiopogon27_contig00043156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00043156 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC11078.1| hypothetical protein: PROVISIONAL [Rhizophagus i... 55 6e-06 dbj|GBC11087.1| hypothetical protein RIR_0019900 [Rhizophagus ir... 54 1e-05 >dbj|GBC11078.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 429 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 454 FRYSKDPKR*NGSVLQYSESVKYGTPDEITTG 359 FRYSKD KR NGSVLQYS+S+KYGTPDE++ G Sbjct: 301 FRYSKDLKRQNGSVLQYSKSIKYGTPDEMSLG 332 >dbj|GBC11087.1| hypothetical protein RIR_0019900 [Rhizophagus irregularis DAOM 181602] Length = 182 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 454 FRYSKDPKR*NGSVLQYSESVKYGTPDE 371 F YSKDPKR NGSVLQYS+S+KYGTPDE Sbjct: 35 FWYSKDPKRRNGSVLQYSKSIKYGTPDE 62