BLASTX nr result
ID: Ophiopogon27_contig00043027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00043027 (1026 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52407.1| hypothetical protein RirG_253360 [Rhizophagus irr... 126 8e-33 >gb|EXX52407.1| hypothetical protein RirG_253360 [Rhizophagus irregularis DAOM 197198w] dbj|GBC51478.1| hypothetical protein RIR_3299300 [Rhizophagus irregularis DAOM 181602] Length = 75 Score = 126 bits (316), Expect = 8e-33 Identities = 64/75 (85%), Positives = 65/75 (86%) Frame = +2 Query: 179 MLPSTSTATDNGSGFSPSLVVDGTEVYQLPNTTVEIPAPESFLPPIYELDIAVPHFALRR 358 MLPSTST T N SGFSP+L D E YQLPNT VEIPAPE FLPPIYELDIAVPHFALRR Sbjct: 1 MLPSTSTVTVNSSGFSPNLSQDVIESYQLPNTVVEIPAPEPFLPPIYELDIAVPHFALRR 60 Query: 359 RNAVVEAVLETPLVF 403 RNAVVEAVLETPLVF Sbjct: 61 RNAVVEAVLETPLVF 75