BLASTX nr result
ID: Ophiopogon27_contig00042969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042969 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus ir... 69 2e-12 >dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus irregularis DAOM 181602] Length = 92 Score = 68.9 bits (167), Expect = 2e-12 Identities = 39/77 (50%), Positives = 41/77 (53%) Frame = -3 Query: 360 FCSKPQDIQPSLNCPFYKYMNFSRTSGLRSRLNVL*IDITPFKGLS*KVPRHGFLTL*F* 181 FCSKPQ IQPSL CP YKYMNFSR +GLRSRLN + I Sbjct: 41 FCSKPQAIQPSLYCPIYKYMNFSRITGLRSRLNFSRLIINS------------------- 81 Query: 180 SAYH*FPPLKTFYFYYR 130 PPLKTF FYYR Sbjct: 82 ------PPLKTFNFYYR 92