BLASTX nr result
ID: Ophiopogon27_contig00042951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042951 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74100.1| hypothetical protein RirG_054280 [Rhizophagus irr... 57 3e-07 >gb|EXX74100.1| hypothetical protein RirG_054280 [Rhizophagus irregularis DAOM 197198w] dbj|GBC35304.1| hypothetical protein RIR_1989700 [Rhizophagus irregularis DAOM 181602] gb|PKC60288.1| hypothetical protein RhiirA1_426080 [Rhizophagus irregularis] gb|PKY29216.1| hypothetical protein RhiirB3_417805 [Rhizophagus irregularis] Length = 135 Score = 57.4 bits (137), Expect = 3e-07 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = +2 Query: 332 NMQRRASES-TSITEFKKIPIMRRYTLPSRINVFTPMIGSENNMRSPFAMFWEAGAGRDS 508 N+QRRASES T +FKK+P+ RRYTLP ++ + + FWEAG RDS Sbjct: 81 NLQRRASESITEAVQFKKLPV-RRYTLPGKLGL---------------SKFWEAG--RDS 122 Query: 509 SVRAAMDNVQFG 544 SV+ AMD+ QFG Sbjct: 123 SVQVAMDHCQFG 134