BLASTX nr result
ID: Ophiopogon27_contig00042904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042904 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38118.1| HSP20-like chaperone [Rhizophagus irregularis] 75 8e-14 gb|PKC14664.1| HSP20-like chaperone [Rhizophagus irregularis] >g... 72 1e-12 gb|EXX75084.1| Sba1p [Rhizophagus irregularis DAOM 197198w] >gi|... 72 1e-12 dbj|GBC51067.1| p23 chaperone protein wos2 [Rhizophagus irregula... 72 1e-12 >gb|PKY38118.1| HSP20-like chaperone [Rhizophagus irregularis] Length = 220 Score = 75.5 bits (184), Expect = 8e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 389 FSNLMGEGPDSALDDSDEEMPGLETVDDTTKINDST 282 FSNLMGEGPDSALDDSDE+MPGLETVDDTTKINDST Sbjct: 132 FSNLMGEGPDSALDDSDEDMPGLETVDDTTKINDST 167 >gb|PKC14664.1| HSP20-like chaperone [Rhizophagus irregularis] gb|PKY22776.1| HSP20-like chaperone [Rhizophagus irregularis] Length = 220 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 389 FSNLMGEGPDSALDDSDEEMPGLETVDDTTKINDST 282 FSNLMGEG DSALDDSDE+MPGLETVDDTTKINDST Sbjct: 132 FSNLMGEGSDSALDDSDEDMPGLETVDDTTKINDST 167 >gb|EXX75084.1| Sba1p [Rhizophagus irregularis DAOM 197198w] gb|PKC72712.1| HSP20-like chaperone [Rhizophagus irregularis] gb|PKK80718.1| HSP20-like chaperone [Rhizophagus irregularis] gb|POG67452.1| HSP20-like chaperone [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 220 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 389 FSNLMGEGPDSALDDSDEEMPGLETVDDTTKINDST 282 FSNLMGEG DSALDDSDE+MPGLETVDDTTKINDST Sbjct: 132 FSNLMGEGSDSALDDSDEDMPGLETVDDTTKINDST 167 >dbj|GBC51067.1| p23 chaperone protein wos2 [Rhizophagus irregularis DAOM 181602] Length = 230 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 389 FSNLMGEGPDSALDDSDEEMPGLETVDDTTKINDST 282 FSNLMGEG DSALDDSDE+MPGLETVDDTTKINDST Sbjct: 132 FSNLMGEGSDSALDDSDEDMPGLETVDDTTKINDST 167