BLASTX nr result
ID: Ophiopogon27_contig00042889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042889 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC69080.1| trimeric LpxA-like protein [Rhizophagus irregularis] 83 3e-17 gb|EXX51252.1| hypothetical protein RirG_263420 [Rhizophagus irr... 83 3e-17 gb|OBZ89890.1| Dynactin subunit 5 [Choanephora cucurbitarum] 70 4e-12 emb|CEP15987.1| hypothetical protein [Parasitella parasitica] 70 4e-12 emb|CEG67297.1| Putative Dynactin 5 [Rhizopus microsporus] 67 5e-12 gb|EPB87949.1| dynactin 5 [Mucor circinelloides f. circinelloide... 69 1e-11 ref|XP_023467725.1| trimeric LpxA-like protein [Rhizopus microsp... 67 3e-11 emb|CEI86266.1| Putative Dynactin 5 [Rhizopus microsporus] >gi|1... 67 3e-11 emb|CDH56431.1| dynactin subunit p25 [Lichtheimia corymbifera JM... 67 5e-11 gb|ORZ12797.1| putative dynactin Arp1 p25 subunit RO12 [Absidia ... 66 1e-10 emb|SAL95016.1| hypothetical protein [Absidia glauca] 66 1e-10 ref|XP_018297738.1| hypothetical protein PHYBLDRAFT_176702 [Phyc... 65 2e-10 emb|CEG67293.1| Putative Dynactin 5 [Rhizopus microsporus] 67 2e-10 gb|ORX55058.1| trimeric LpxA-like protein [Hesseltinella vesicul... 65 5e-10 gb|ORZ00569.1| trimeric LpxA-like protein [Syncephalastrum racem... 64 7e-10 gb|ORY05116.1| putative dynactin Arp1 p25 subunit RO12 [Basidiob... 63 1e-09 gb|OZJ05803.1| hypothetical protein BZG36_00872 [Bifiguratus ade... 62 5e-09 gb|KNE70610.1| hypothetical protein AMAG_15370 [Allomyces macrog... 61 1e-08 gb|KFH67695.1| dynactin 5 [Mortierella verticillata NRRL 6337] 59 5e-08 gb|OAQ32153.1| putative dynactin Arp1 p25 subunit RO12 [Mortiere... 57 2e-07 >gb|PKC69080.1| trimeric LpxA-like protein [Rhizophagus irregularis] Length = 188 Score = 83.2 bits (204), Expect = 3e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFSIYEGSPG+FVDELPECVQDLYE KTKDYYAKFQPKD Sbjct: 150 SFSIYEGSPGVFVDELPECVQDLYESKTKDYYAKFQPKD 188 >gb|EXX51252.1| hypothetical protein RirG_263420 [Rhizophagus irregularis DAOM 197198w] dbj|GBC26710.1| Dynactin 5 [Rhizophagus irregularis DAOM 181602] gb|PKC05936.1| trimeric LpxA-like protein [Rhizophagus irregularis] gb|PKK75450.1| trimeric LpxA-like protein [Rhizophagus irregularis] gb|PKY18462.1| trimeric LpxA-like protein [Rhizophagus irregularis] gb|PKY44566.1| trimeric LpxA-like protein [Rhizophagus irregularis] gb|POG73289.1| trimeric LpxA-like protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 188 Score = 83.2 bits (204), Expect = 3e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFSIYEGSPG+FVDELPECVQDLYE KTKDYYAKFQPKD Sbjct: 150 SFSIYEGSPGVFVDELPECVQDLYESKTKDYYAKFQPKD 188 >gb|OBZ89890.1| Dynactin subunit 5 [Choanephora cucurbitarum] Length = 188 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF PKD Sbjct: 150 SFSVYSGSPGKYQDELPECTQELYENKTKDYYAKFMPKD 188 >emb|CEP15987.1| hypothetical protein [Parasitella parasitica] Length = 188 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF PKD Sbjct: 150 SFSVYSGSPGKYQDELPECTQELYENKTKDYYAKFMPKD 188 >emb|CEG67297.1| Putative Dynactin 5 [Rhizopus microsporus] Length = 96 Score = 67.4 bits (163), Expect = 5e-12 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF P+D Sbjct: 58 SFSVYGGSPGKYQDELPECTQELYENKTKDYYAKFTPRD 96 >gb|EPB87949.1| dynactin 5 [Mucor circinelloides f. circinelloides 1006PhL] gb|OAD06024.1| hypothetical protein MUCCIDRAFT_176557 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 188 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF PKD Sbjct: 150 SFSVYSGSPGKYQDELPECTQELYENKTKDYYAKFIPKD 188 >ref|XP_023467725.1| trimeric LpxA-like protein [Rhizopus microsporus ATCC 52813] gb|ORE11766.1| trimeric LpxA-like protein [Rhizopus microsporus var. microsporus] gb|PHZ14017.1| trimeric LpxA-like protein [Rhizopus microsporus ATCC 52813] Length = 188 Score = 67.4 bits (163), Expect = 3e-11 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF P+D Sbjct: 150 SFSVYGGSPGKYQDELPECTQELYENKTKDYYAKFTPRD 188 >emb|CEI86266.1| Putative Dynactin 5 [Rhizopus microsporus] gb|ORE18694.1| trimeric LpxA-like protein [Rhizopus microsporus] Length = 188 Score = 67.4 bits (163), Expect = 3e-11 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF P+D Sbjct: 150 SFSVYGGSPGKYQDELPECTQELYENKTKDYYAKFTPRD 188 >emb|CDH56431.1| dynactin subunit p25 [Lichtheimia corymbifera JMRC:FSU:9682] emb|CDS07575.1| Putative Dynactin 5 [Lichtheimia ramosa] Length = 188 Score = 67.0 bits (162), Expect = 5e-11 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG F DELPEC Q+LYE +TKDYYAKF KD Sbjct: 150 SFSVYSGSPGTFQDELPECTQELYEKRTKDYYAKFTAKD 188 >gb|ORZ12797.1| putative dynactin Arp1 p25 subunit RO12 [Absidia repens] Length = 188 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE K+KDYYAKF P D Sbjct: 150 SFSVYSGSPGAYQDELPECTQELYENKSKDYYAKFTPLD 188 >emb|SAL95016.1| hypothetical protein [Absidia glauca] Length = 188 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE K+KDYYAKF P D Sbjct: 150 SFSVYSGSPGAYQDELPECTQELYENKSKDYYAKFTPLD 188 >ref|XP_018297738.1| hypothetical protein PHYBLDRAFT_176702 [Phycomyces blakesleeanus NRRL 1555(-)] gb|OAD79698.1| hypothetical protein PHYBLDRAFT_176702 [Phycomyces blakesleeanus NRRL 1555(-)] Length = 188 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYY+KF KD Sbjct: 150 SFSVYSGSPGSYQDELPECTQELYENKTKDYYSKFTAKD 188 >emb|CEG67293.1| Putative Dynactin 5 [Rhizopus microsporus] Length = 455 Score = 67.4 bits (163), Expect = 2e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG + DELPEC Q+LYE KTKDYYAKF P+D Sbjct: 417 SFSVYGGSPGKYQDELPECTQELYENKTKDYYAKFTPRD 455 >gb|ORX55058.1| trimeric LpxA-like protein [Hesseltinella vesiculosa] Length = 212 Score = 64.7 bits (156), Expect = 5e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFS+Y GSPG DELPEC Q+LYE KTKDYYAKF P D Sbjct: 174 SFSVYAGSPGACQDELPECTQELYENKTKDYYAKFTPID 212 >gb|ORZ00569.1| trimeric LpxA-like protein [Syncephalastrum racemosum] Length = 188 Score = 63.9 bits (154), Expect = 7e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPKD 158 SFSI+ GSPG + ELPEC Q+LYE +TKDYYAKFQ KD Sbjct: 150 SFSIFTGSPGTYQGELPECTQELYESQTKDYYAKFQAKD 188 >gb|ORY05116.1| putative dynactin Arp1 p25 subunit RO12 [Basidiobolus meristosporus CBS 931.73] Length = 188 Score = 63.2 bits (152), Expect = 1e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQP 152 SFS+Y GSPG+FVDELPE Q+++E +TKDYY+KF P Sbjct: 150 SFSVYSGSPGVFVDELPESTQEMFEARTKDYYSKFTP 186 >gb|OZJ05803.1| hypothetical protein BZG36_00872 [Bifiguratus adelaidae] Length = 187 Score = 61.6 bits (148), Expect = 5e-09 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPK 155 SFSIYEG+PG F ELPEC Q++YE+ T+DYY KF P+ Sbjct: 149 SFSIYEGTPGTFNSELPECTQEMYELATRDYYTKFVPQ 186 >gb|KNE70610.1| hypothetical protein AMAG_15370 [Allomyces macrogynus ATCC 38327] Length = 188 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQPK 155 SFSI GSPG+ ELPEC+QD+YE +TKDYYAKF P+ Sbjct: 150 SFSIVRGSPGLCAGELPECIQDVYEQETKDYYAKFVPR 187 >gb|KFH67695.1| dynactin 5 [Mortierella verticillata NRRL 6337] Length = 189 Score = 58.9 bits (141), Expect = 5e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQP 152 SFS+Y+GSPG VDELPE +QD+YE +TKD Y+KF P Sbjct: 150 SFSVYKGSPGKLVDELPESIQDIYEAQTKDRYSKFVP 186 >gb|OAQ32153.1| putative dynactin Arp1 p25 subunit RO12 [Mortierella elongata AG-77] Length = 188 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 42 SFSIYEGSPGIFVDELPECVQDLYEIKTKDYYAKFQP 152 SFS+Y+GSPG VDELPE +QD+ E +TKD YAKF P Sbjct: 150 SFSVYKGSPGKLVDELPESIQDIIEARTKDRYAKFVP 186