BLASTX nr result
ID: Ophiopogon27_contig00042654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042654 (602 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus ir... 155 2e-45 gb|PKK76579.1| hypothetical protein RhiirC2_733879 [Rhizophagus ... 56 2e-07 >dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus irregularis DAOM 181602] gb|PKC12801.1| hypothetical protein RhiirA5_352523 [Rhizophagus irregularis] gb|PKC68017.1| hypothetical protein RhiirA1_417379 [Rhizophagus irregularis] gb|PKY18041.1| hypothetical protein RhiirB3_405039 [Rhizophagus irregularis] gb|PKY38324.1| hypothetical protein RhiirA4_391803 [Rhizophagus irregularis] Length = 99 Score = 155 bits (391), Expect = 2e-45 Identities = 74/82 (90%), Positives = 76/82 (92%), Gaps = 3/82 (3%) Frame = -1 Query: 494 MSQAQE--DEYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREGSSH-GHHGGYDESFFPS 324 MSQ E D+YFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREGSSH GHHGGY+ESFFPS Sbjct: 1 MSQMPEGDDDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREGSSHHGHHGGYEESFFPS 60 Query: 323 PTHPHHKGGAHHRQNQQGDKTV 258 P HPHHKGGAHHRQNQQGDKTV Sbjct: 61 P-HPHHKGGAHHRQNQQGDKTV 81 >gb|PKK76579.1| hypothetical protein RhiirC2_733879 [Rhizophagus irregularis] Length = 54 Score = 55.8 bits (133), Expect = 2e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 364 MVIMEVTMKVSFQVLHTHIIKVVLIIDKINREIKQWIK 251 MVIMEV KV FQVL HIIKV LIIDKIN+EIK+WIK Sbjct: 1 MVIMEVMKKVFFQVL-IHIIKVALIIDKINKEIKRWIK 37