BLASTX nr result
ID: Ophiopogon27_contig00042567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042567 (810 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY50760.1| Pkinase-domain-containing protein [Rhizophagus ir... 123 1e-29 gb|PKK65363.1| Pkinase-domain-containing protein [Rhizophagus ir... 123 1e-29 gb|PKC59222.1| Pkinase-domain-containing protein [Rhizophagus ir... 123 1e-29 gb|PKC02400.1| Pkinase-domain-containing protein [Rhizophagus ir... 123 1e-29 dbj|GBC35792.1| serine/threonine protein kinase [Rhizophagus irr... 123 4e-28 emb|SAL99350.1| hypothetical protein [Absidia glauca] 72 2e-10 gb|ORZ23009.1| hypothetical protein BCR42DRAFT_343364 [Absidia r... 72 2e-10 emb|SAM03657.1| hypothetical protein [Absidia glauca] 70 6e-10 emb|CEP14689.1| hypothetical protein [Parasitella parasitica] 69 2e-09 gb|EPB88583.1| CAMK/CAMKL/MARK protein kinase [Mucor circinelloi... 69 2e-09 dbj|GAN04755.1| pkinase-domain-containing protein [Mucor ambiguus] 69 2e-09 emb|CEG76565.1| Putative CAMK/CAMKL/MARK protein kinase [Rhizopu... 67 5e-09 gb|ORE23149.1| Pkinase-domain-containing protein [Rhizopus micro... 67 8e-09 ref|XP_023461822.1| Pkinase-domain-containing protein [Rhizopus ... 67 8e-09 gb|ORE10437.1| Pkinase-domain-containing protein [Rhizopus micro... 67 8e-09 emb|CEJ02469.1| Putative CAMK/CAMKL protein kinase [Rhizopus mic... 67 8e-09 emb|CEG68324.1| Putative CAMK/CAMKL protein kinase [Rhizopus mic... 67 8e-09 emb|CEI91534.1| Putative CAMK/CAMKL protein kinase [Rhizopus mic... 67 8e-09 gb|ORY97534.1| hypothetical protein BCR43DRAFT_489935 [Syncephal... 67 8e-09 gb|OBZ88793.1| MAP/microtubule affinity-regulating kinase 4 [Cho... 67 8e-09 >gb|PKY50760.1| Pkinase-domain-containing protein [Rhizophagus irregularis] Length = 326 Score = 123 bits (309), Expect = 1e-29 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 621 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELST NIRSVGNY LEDTLGEGTYGKVK Sbjct: 1 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTKNIRSVGNYALEDTLGEGTYGKVK 60 Query: 801 LAT 809 LAT Sbjct: 61 LAT 63 >gb|PKK65363.1| Pkinase-domain-containing protein [Rhizophagus irregularis] Length = 326 Score = 123 bits (309), Expect = 1e-29 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 621 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELST NIRSVGNY LEDTLGEGTYGKVK Sbjct: 1 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTKNIRSVGNYALEDTLGEGTYGKVK 60 Query: 801 LAT 809 LAT Sbjct: 61 LAT 63 >gb|PKC59222.1| Pkinase-domain-containing protein [Rhizophagus irregularis] gb|PKY28675.1| Pkinase-domain-containing protein [Rhizophagus irregularis] gb|POG58368.1| kinase-like domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 326 Score = 123 bits (309), Expect = 1e-29 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 621 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELST NIRSVGNY LEDTLGEGTYGKVK Sbjct: 1 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTKNIRSVGNYALEDTLGEGTYGKVK 60 Query: 801 LAT 809 LAT Sbjct: 61 LAT 63 >gb|PKC02400.1| Pkinase-domain-containing protein [Rhizophagus irregularis] Length = 326 Score = 123 bits (309), Expect = 1e-29 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 621 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELST NIRSVGNY LEDTLGEGTYGKVK Sbjct: 1 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTKNIRSVGNYALEDTLGEGTYGKVK 60 Query: 801 LAT 809 LAT Sbjct: 61 LAT 63 >dbj|GBC35792.1| serine/threonine protein kinase [Rhizophagus irregularis DAOM 181602] Length = 1140 Score = 123 bits (309), Expect = 4e-28 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 621 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELST NIRSVGNY LEDTLGEGTYGKVK Sbjct: 1 MHMSYGKTRVAGVPNTRNQRAKLAADYQELLKELSTKNIRSVGNYALEDTLGEGTYGKVK 60 Query: 801 LAT 809 LAT Sbjct: 61 LAT 63 >emb|SAL99350.1| hypothetical protein [Absidia glauca] Length = 1002 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +3 Query: 669 RNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 RNQ+AKLAADY +LLKELS+ + SVG YT+ DT+GEGTYGKVKL T Sbjct: 10 RNQKAKLAADYNDLLKELSSREMTSVGCYTIGDTIGEGTYGKVKLGT 56 >gb|ORZ23009.1| hypothetical protein BCR42DRAFT_343364 [Absidia repens] Length = 1041 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +3 Query: 669 RNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 RNQ+AKLAADY +LLKELS+ + SVG YT+ DT+GEGTYGKVKL T Sbjct: 9 RNQKAKLAADYNDLLKELSSREMASVGCYTIGDTIGEGTYGKVKLGT 55 >emb|SAM03657.1| hypothetical protein [Absidia glauca] Length = 1052 Score = 70.5 bits (171), Expect = 6e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 669 RNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 RNQ+AKLAADY ELLKELS+ + S+G YT+ DT+GEGT+GKVK+ T Sbjct: 9 RNQKAKLAADYNELLKELSSREMTSIGCYTIGDTIGEGTFGKVKIGT 55 >emb|CEP14689.1| hypothetical protein [Parasitella parasitica] Length = 975 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +3 Query: 666 TRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 T NQ+AKLA DY ELLKELS+H + SVG YT+ +T+GEGT+GKVK T Sbjct: 10 THNQQAKLAVDYNELLKELSSHEMTSVGCYTIGETIGEGTFGKVKKGT 57 >gb|EPB88583.1| CAMK/CAMKL/MARK protein kinase [Mucor circinelloides f. circinelloides 1006PhL] Length = 975 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +3 Query: 666 TRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 T NQ+AKLA DY ELLKELS+H + SVG YT+ +T+GEGT+GKVK T Sbjct: 10 THNQQAKLAVDYNELLKELSSHEMTSVGCYTIGETIGEGTFGKVKKGT 57 >dbj|GAN04755.1| pkinase-domain-containing protein [Mucor ambiguus] Length = 980 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +3 Query: 666 TRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 T NQ+AKLA DY ELLKELS+H + SVG YT+ +T+GEGT+GKVK T Sbjct: 10 THNQQAKLAVDYNELLKELSSHEMTSVGCYTIGETIGEGTFGKVKKGT 57 >emb|CEG76565.1| Putative CAMK/CAMKL/MARK protein kinase [Rhizopus microsporus] Length = 341 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >gb|ORE23149.1| Pkinase-domain-containing protein [Rhizopus microsporus] Length = 820 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >ref|XP_023461822.1| Pkinase-domain-containing protein [Rhizopus microsporus ATCC 52813] ref|XP_023461458.1| Pkinase-domain-containing protein [Rhizopus microsporus ATCC 52813] gb|PHZ07750.1| Pkinase-domain-containing protein [Rhizopus microsporus ATCC 52813] gb|PHZ08114.1| Pkinase-domain-containing protein [Rhizopus microsporus ATCC 52813] Length = 821 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >gb|ORE10437.1| Pkinase-domain-containing protein [Rhizopus microsporus var. microsporus] Length = 821 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >emb|CEJ02469.1| Putative CAMK/CAMKL protein kinase [Rhizopus microsporus] Length = 821 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >emb|CEG68324.1| Putative CAMK/CAMKL protein kinase [Rhizopus microsporus] Length = 822 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >emb|CEI91534.1| Putative CAMK/CAMKL protein kinase [Rhizopus microsporus] Length = 827 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVK 800 NQ+AKLA DY ELLKELS+H I SVG YT+ +T+GEGT+GKVK Sbjct: 12 NQQAKLAVDYNELLKELSSHEITSVGCYTIGETIGEGTFGKVK 54 >gb|ORY97534.1| hypothetical protein BCR43DRAFT_489935 [Syncephalastrum racemosum] Length = 856 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +3 Query: 663 NTRNQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKL 803 NT NQ+AKLAADY +LLKELS+ + +VG Y++ +T+GEGTYGKVKL Sbjct: 10 NTHNQKAKLAADYNDLLKELSSPKMLTVGCYSIGETIGEGTYGKVKL 56 >gb|OBZ88793.1| MAP/microtubule affinity-regulating kinase 4 [Choanephora cucurbitarum] Length = 906 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +3 Query: 672 NQRAKLAADYQELLKELSTHNIRSVGNYTLEDTLGEGTYGKVKLAT 809 NQ+AKLA DY ELLKELS+H + SVG YT+ +T+GEGT+GKVK T Sbjct: 12 NQQAKLAVDYNELLKELSSHEMTSVGCYTIGETIGEGTFGKVKKGT 57