BLASTX nr result
ID: Ophiopogon27_contig00042506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042506 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY30649.1| WD40 repeat-like protein [Rhizophagus irregularis] 94 7e-20 gb|PKK63795.1| WD40 repeat-like protein [Rhizophagus irregularis] 94 7e-20 gb|EXX58517.1| Cdh1p [Rhizophagus irregularis DAOM 197198w] >gi|... 94 7e-20 >gb|PKY30649.1| WD40 repeat-like protein [Rhizophagus irregularis] Length = 496 Score = 94.0 bits (232), Expect = 7e-20 Identities = 49/64 (76%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = +2 Query: 191 MPQQTGNNFDQAHQISSGAQRSEQNSTTVSPVRS-INITTQRNRSVTYDRHIPQRTPDPV 367 M Q TGN+ DQAHQ S G +RSEQNSTTVSPVR+ IN TTQR TYDRHIPQRTPDPV Sbjct: 1 MSQHTGNHSDQAHQNSPGVRRSEQNSTTVSPVRTIINTTTQR---TTYDRHIPQRTPDPV 57 Query: 368 NDYR 379 NDYR Sbjct: 58 NDYR 61 >gb|PKK63795.1| WD40 repeat-like protein [Rhizophagus irregularis] Length = 496 Score = 94.0 bits (232), Expect = 7e-20 Identities = 49/64 (76%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = +2 Query: 191 MPQQTGNNFDQAHQISSGAQRSEQNSTTVSPVRS-INITTQRNRSVTYDRHIPQRTPDPV 367 M Q TGN+ DQAHQ S G +RSEQNSTTVSPVR+ IN TTQR TYDRHIPQRTPDPV Sbjct: 1 MSQHTGNHSDQAHQNSPGVRRSEQNSTTVSPVRTIINTTTQR---TTYDRHIPQRTPDPV 57 Query: 368 NDYR 379 NDYR Sbjct: 58 NDYR 61 >gb|EXX58517.1| Cdh1p [Rhizophagus irregularis DAOM 197198w] gb|EXX58518.1| Cdh1p [Rhizophagus irregularis DAOM 197198w] gb|EXX58519.1| Cdh1p [Rhizophagus irregularis DAOM 197198w] dbj|GBC17142.1| WD40 domain-containing protein [Rhizophagus irregularis DAOM 181602] gb|PKC00148.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|PKC57838.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|PKY55872.1| WD40 repeat-like protein [Rhizophagus irregularis] gb|POG75350.1| cell cycle regulatory protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 496 Score = 94.0 bits (232), Expect = 7e-20 Identities = 49/64 (76%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = +2 Query: 191 MPQQTGNNFDQAHQISSGAQRSEQNSTTVSPVRS-INITTQRNRSVTYDRHIPQRTPDPV 367 M Q TGN+ DQAHQ S G +RSEQNSTTVSPVR+ IN TTQR TYDRHIPQRTPDPV Sbjct: 1 MSQHTGNHSDQAHQNSPGVRRSEQNSTTVSPVRTIINTTTQR---TTYDRHIPQRTPDPV 57 Query: 368 NDYR 379 NDYR Sbjct: 58 NDYR 61