BLASTX nr result
ID: Ophiopogon27_contig00042378
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042378 (670 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX77540.1| hypothetical protein RirG_022930 [Rhizophagus irr... 59 4e-08 >gb|EXX77540.1| hypothetical protein RirG_022930 [Rhizophagus irregularis DAOM 197198w] Length = 92 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +1 Query: 517 IVFAKSFGDRQDEHLLYKICLEKLRLKPQLLRSCSSELVDKLVSNCISSFE 669 IV+ +SFG +++EH YKICLEKL P L+ S SE V K+ S C+ SFE Sbjct: 35 IVYIESFGKKEEEHRTYKICLEKLVESPHLINSHDSETVQKMASQCLESFE 85