BLASTX nr result
ID: Ophiopogon27_contig00042304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042304 (622 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX59687.1| hypothetical protein RirG_186840 [Rhizophagus irr... 159 3e-64 gb|EXX59688.1| hypothetical protein RirG_186840 [Rhizophagus irr... 175 2e-51 gb|PKY50815.1| hypothetical protein RhiirA4_406893 [Rhizophagus ... 114 6e-28 gb|EXX59689.1| hypothetical protein RirG_186840 [Rhizophagus irr... 114 6e-28 gb|PKK72341.1| hypothetical protein RhiirC2_742973 [Rhizophagus ... 112 5e-27 >gb|EXX59687.1| hypothetical protein RirG_186840 [Rhizophagus irregularis DAOM 197198w] gb|POG77898.1| hypothetical protein GLOIN_2v1542388 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 297 Score = 159 bits (402), Expect(2) = 3e-64 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -3 Query: 377 LLPLGFSYIFNFEPHRNLYSPLTFSVAQYAIFMVSVSNFDWAEDVRDFIPDNLIYMGAGT 198 LLPLGFSYIFNFEPHRNLYSPLTFSVAQYAIFMVSVSNFDWAEDVRDFIPDNLIYMGAGT Sbjct: 221 LLPLGFSYIFNFEPHRNLYSPLTFSVAQYAIFMVSVSNFDWAEDVRDFIPDNLIYMGAGT 280 Query: 197 GAIFALYESILANSDTT 147 GAIFALYESILANSDTT Sbjct: 281 GAIFALYESILANSDTT 297 Score = 114 bits (285), Expect(2) = 3e-64 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = -2 Query: 621 FLIQLRKNISNSTTFCKFVTCLELLVFLYCAIEWSLKIASIPIPYLGSEESYNYDLH 451 FLIQLRKNISNSTTFCK VTCLELLVFLYCAIEWSLKIASIPIP LGSEESYNYDLH Sbjct: 139 FLIQLRKNISNSTTFCKAVTCLELLVFLYCAIEWSLKIASIPIPNLGSEESYNYDLH 195 >gb|EXX59688.1| hypothetical protein RirG_186840 [Rhizophagus irregularis DAOM 197198w] Length = 231 Score = 175 bits (443), Expect = 2e-51 Identities = 90/118 (76%), Positives = 90/118 (76%) Frame = -2 Query: 621 FLIQLRKNISNSTTFCKFVTCLELLVFLYCAIEWSLKIASIPIPYLGSEESYNYDLHXXX 442 FLIQLRKNISNSTTFCK VTCLELLVFLYCAIEWSLKIASIPIP LGSEESYNYD Sbjct: 139 FLIQLRKNISNSTTFCKAVTCLELLVFLYCAIEWSLKIASIPIPNLGSEESYNYDF---- 194 Query: 441 XXXXXXXXXXXXXXXXXXXXXTLTTGVFIYLQFRATSQFIQSSNFLCCPICNFHGLCF 268 TLTTGVFIYLQFRATSQFIQSSNFLCCPICNFHGLCF Sbjct: 195 ---------------------TLTTGVFIYLQFRATSQFIQSSNFLCCPICNFHGLCF 231 >gb|PKY50815.1| hypothetical protein RhiirA4_406893 [Rhizophagus irregularis] Length = 217 Score = 114 bits (285), Expect = 6e-28 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = -2 Query: 621 FLIQLRKNISNSTTFCKFVTCLELLVFLYCAIEWSLKIASIPIPYLGSEESYNYDLH 451 FLIQLRKNISNSTTFCK VTCLELLVFLYCAIEWSLKIASIPIP LGSEESYNYDLH Sbjct: 139 FLIQLRKNISNSTTFCKAVTCLELLVFLYCAIEWSLKIASIPIPNLGSEESYNYDLH 195 >gb|EXX59689.1| hypothetical protein RirG_186840 [Rhizophagus irregularis DAOM 197198w] dbj|GBC46548.1| hypothetical protein RIR_2892600 [Rhizophagus irregularis DAOM 181602] gb|PKC07105.1| hypothetical protein RhiirA5_359541 [Rhizophagus irregularis] gb|PKC63716.1| hypothetical protein RhiirA1_422433 [Rhizophagus irregularis] gb|PKY16407.1| hypothetical protein RhiirB3_402851 [Rhizophagus irregularis] Length = 217 Score = 114 bits (285), Expect = 6e-28 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = -2 Query: 621 FLIQLRKNISNSTTFCKFVTCLELLVFLYCAIEWSLKIASIPIPYLGSEESYNYDLH 451 FLIQLRKNISNSTTFCK VTCLELLVFLYCAIEWSLKIASIPIP LGSEESYNYDLH Sbjct: 139 FLIQLRKNISNSTTFCKAVTCLELLVFLYCAIEWSLKIASIPIPNLGSEESYNYDLH 195 >gb|PKK72341.1| hypothetical protein RhiirC2_742973 [Rhizophagus irregularis] Length = 217 Score = 112 bits (279), Expect = 5e-27 Identities = 54/57 (94%), Positives = 54/57 (94%) Frame = -2 Query: 621 FLIQLRKNISNSTTFCKFVTCLELLVFLYCAIEWSLKIASIPIPYLGSEESYNYDLH 451 FLIQLRKNISNST FCK VTCLELLVFLYCAIEWSLKIASIPIP LGSEESYNYDLH Sbjct: 139 FLIQLRKNISNSTIFCKAVTCLELLVFLYCAIEWSLKIASIPIPNLGSEESYNYDLH 195