BLASTX nr result
ID: Ophiopogon27_contig00042172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00042172 (591 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK76855.1| hypothetical protein RhiirC2_812555 [Rhizophagus ... 72 2e-12 gb|PKC09870.1| hypothetical protein RhiirA5_375119 [Rhizophagus ... 64 1e-09 dbj|GBC18105.1| hypothetical protein RIR_0593800 [Rhizophagus ir... 64 1e-09 gb|PKY46584.1| hypothetical protein RhiirA4_420743 [Rhizophagus ... 62 4e-09 >gb|PKK76855.1| hypothetical protein RhiirC2_812555 [Rhizophagus irregularis] Length = 138 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/63 (57%), Positives = 49/63 (77%) Frame = -2 Query: 422 ENKRSFGPFGENAVNFTAIAGLAGGSFITVWNKIDKLSDEMSIMRREMGDIKQDIGMIKG 243 +NK S FG N VN AI GLAGGSFIT++ KI+KLSDE+ +++ ++G IK++IG+ KG Sbjct: 47 DNKNS--SFGRNVVNIAAIVGLAGGSFITIY-KINKLSDEIGVIKEDIGLIKENIGLTKG 103 Query: 242 YLF 234 YLF Sbjct: 104 YLF 106 >gb|PKC09870.1| hypothetical protein RhiirA5_375119 [Rhizophagus irregularis] gb|PKC58833.1| hypothetical protein RhiirA1_400378 [Rhizophagus irregularis] gb|PKY28324.1| hypothetical protein RhiirB3_390967 [Rhizophagus irregularis] Length = 131 Score = 63.9 bits (154), Expect = 1e-09 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -2 Query: 422 ENKRSFGPFGENAVNFTAIAGLAGGSFITVWNKIDKLSDEMSIMRREMGDIKQDIGMIKG 243 +NK S FG N VN AI GLAGGSFIT++ KI+KL D E+G IK+DIG+IKG Sbjct: 47 DNKNS--SFGRNVVNIAAIVGLAGGSFITIY-KINKLGD-------EIGVIKEDIGLIKG 96 Query: 242 YLF 234 YLF Sbjct: 97 YLF 99 >dbj|GBC18105.1| hypothetical protein RIR_0593800 [Rhizophagus irregularis DAOM 181602] gb|POG59835.1| hypothetical protein GLOIN_2v1487499 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 131 Score = 63.9 bits (154), Expect = 1e-09 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -2 Query: 422 ENKRSFGPFGENAVNFTAIAGLAGGSFITVWNKIDKLSDEMSIMRREMGDIKQDIGMIKG 243 +NK S FG N VN AI GLAGGSFIT++ KI+KL D E+G IK+DIG+IKG Sbjct: 47 DNKNS--SFGRNVVNIAAIVGLAGGSFITIY-KINKLGD-------EIGVIKEDIGLIKG 96 Query: 242 YLF 234 YLF Sbjct: 97 YLF 99 >gb|PKY46584.1| hypothetical protein RhiirA4_420743 [Rhizophagus irregularis] Length = 123 Score = 62.4 bits (150), Expect = 4e-09 Identities = 33/62 (53%), Positives = 44/62 (70%), Gaps = 7/62 (11%) Frame = -2 Query: 398 FGENAVNFTAIAGLAGGSFITVWNKIDKLSDEMSIMRREMGDIKQDIGMI-------KGY 240 FG N VN AI GLAG SFIT++ KI+KL DE+ +++ ++G IK+DIG+I KGY Sbjct: 31 FGRNVVNIAAIVGLAGCSFITIY-KINKLGDEIGVIKEDIGVIKEDIGVIKENIGLTKGY 89 Query: 239 LF 234 LF Sbjct: 90 LF 91