BLASTX nr result
ID: Ophiopogon27_contig00041935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00041935 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX72145.1| hypothetical protein RirG_072160 [Rhizophagus irr... 82 2e-27 gb|PKK79189.1| hypothetical protein RhiirC2_431458 [Rhizophagus ... 69 2e-11 >gb|EXX72145.1| hypothetical protein RirG_072160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC40159.1| hypothetical protein RIR_2377500 [Rhizophagus irregularis DAOM 181602] gb|PKC11193.1| hypothetical protein RhiirA5_468496 [Rhizophagus irregularis] gb|PKC74050.1| hypothetical protein RhiirA1_450432 [Rhizophagus irregularis] gb|PKY17736.1| hypothetical protein RhiirB3_382761 [Rhizophagus irregularis] gb|PKY45928.1| hypothetical protein RhiirA4_179160 [Rhizophagus irregularis] gb|POG81662.1| hypothetical protein GLOIN_2v1762899 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 230 Score = 81.6 bits (200), Expect(2) = 2e-27 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -2 Query: 363 SSPVQQQQNSRQLPSSTLNPVVDPMTEIVAALKMPIDGNFDQKLVV 226 SSPVQQQ RQLPSSTLNPVVDPMTEIVAALKMPIDGNFDQKLVV Sbjct: 188 SSPVQQQ---RQLPSSTLNPVVDPMTEIVAALKMPIDGNFDQKLVV 230 Score = 68.6 bits (166), Expect(2) = 2e-27 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = -1 Query: 547 AAALSLEGLNIGSTIPSAXXXXXXXXXDIKNHETPTLTSISSEQQIVTD 401 AAALSLEGLNIGSTIPSA IKNHETPTLTSISSEQQIVTD Sbjct: 105 AAALSLEGLNIGSTIPSANDTNTNNND-IKNHETPTLTSISSEQQIVTD 152 >gb|PKK79189.1| hypothetical protein RhiirC2_431458 [Rhizophagus irregularis] Length = 144 Score = 68.6 bits (166), Expect = 2e-11 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = -1 Query: 547 AAALSLEGLNIGSTIPSAXXXXXXXXXDIKNHETPTLTSISSEQQIVTD 401 AAALSLEGLNIGSTIPSA IKNHETPTLTSISSEQQIVTD Sbjct: 58 AAALSLEGLNIGSTIPSANDTNTNNND-IKNHETPTLTSISSEQQIVTD 105