BLASTX nr result
ID: Ophiopogon27_contig00041325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00041325 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC31352.1| ccch zinc finger domain protein [Rhizophagus irr... 102 7e-24 >dbj|GBC31352.1| ccch zinc finger domain protein [Rhizophagus irregularis DAOM 181602] Length = 309 Score = 102 bits (254), Expect = 7e-24 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 289 LNYGLKLICKFKRNEKCICFLYIYITKWICFIRVSLYQEYKRLAIMNY 146 LNYGLKLICKFKRNEKCICFLYIYITKWICFIRVSLYQEYKRL +M Y Sbjct: 260 LNYGLKLICKFKRNEKCICFLYIYITKWICFIRVSLYQEYKRLVVMKY 307